KEGG   Mus caroli (Ryukyu mouse): 110310313
Entry
110310313         CDS       T05910                                 

Gene name
Ep300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04310  Wnt signaling pathway
mcal04330  Notch signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04520  Adherens junction
mcal04630  JAK-STAT signaling pathway
mcal04720  Long-term potentiation
mcal04916  Melanogenesis
mcal04919  Thyroid hormone signaling pathway
mcal04922  Glucagon signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05016  Huntington disease
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110310313 (Ep300)
   04330 Notch signaling pathway
    110310313 (Ep300)
   04350 TGF-beta signaling pathway
    110310313 (Ep300)
   04630 JAK-STAT signaling pathway
    110310313 (Ep300)
   04066 HIF-1 signaling pathway
    110310313 (Ep300)
   04068 FoxO signaling pathway
    110310313 (Ep300)
   04024 cAMP signaling pathway
    110310313 (Ep300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110310313 (Ep300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110310313 (Ep300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110310313 (Ep300)
   04935 Growth hormone synthesis, secretion and action
    110310313 (Ep300)
   04919 Thyroid hormone signaling pathway
    110310313 (Ep300)
   04916 Melanogenesis
    110310313 (Ep300)
  09156 Nervous system
   04720 Long-term potentiation
    110310313 (Ep300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310313 (Ep300)
   05206 MicroRNAs in cancer
    110310313 (Ep300)
   05203 Viral carcinogenesis
    110310313 (Ep300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110310313 (Ep300)
   05215 Prostate cancer
    110310313 (Ep300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110310313 (Ep300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110310313 (Ep300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110310313 (Ep300)
   05161 Hepatitis B
    110310313 (Ep300)
   05164 Influenza A
    110310313 (Ep300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110310313 (Ep300)
   05165 Human papillomavirus infection
    110310313 (Ep300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110310313 (Ep300)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110310313 (Ep300)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110310313 (Ep300)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110310313 (Ep300)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    110310313 (Ep300)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110310313 (Ep300)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    110310313 (Ep300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 110310313
NCBI-ProteinID: XP_021038805
Ensembl: MGP_CAROLIEiJ_G0020054
UniProt: A0A6P5R5C4
LinkDB
Position
15
AA seq 2421 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLSLINS
MVKSPMAQTGLTSPNMGIGSSGPNPGPTQSPAGMMNSPVNQPAMGMNTGMNAGMNPGMLA
AGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTEPLQQGSPQMGGQPGLRGP
QPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVLPNNLSPFAMDKKAVPGGGM
PSMGQQPAPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
IPPQPQVQAKNQQSQPSGQSPQGMRSMNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINS
QNPMMSENASVASLGPLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAPGMGPVPMNTGSNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMN
MPQPPIGPRQPSPLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTN
MPLAPSSGQVPVSQAQMSSSSCPVNSPVMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTP
TPHHTPPSIGTQPPPATAIPPPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSL
PAAPSADQSQQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTE
VNSQTIPEKQPSQEVKMEAKMEVEQPEPADTQPDDTKEAKAEDVKVEPTEIEERGPELKT
EGKEEEDQPSTSATQSSPAPGQSKKKMFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKY
CSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFC
EKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLH
HEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEV
TVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEY
GSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGALTAHLEVLSSI
PSNHRVAHNHLXWEDLMPSSGFXRQLQCTYRHKXTFIKEKILILGIFLQDILKQATEDRL
TSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKK
TSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIACPAPNSLPPIVDP
DPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKH
HVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSI
QRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKH
CQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVAGQQQGLPSPTPATP
TTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRTQTTGPVSQGKAAGQVTPPTPPQT
AQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQIPQMTPMAPMGMNPPPMA
RGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQSGMPRPAMMSVAQHGQPLNMAPQPGL
GQVGVSPLKPGTVSQQALQSLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYA
NPNSQPLPGQPGMPQGQPGLQPPTMPGQQGVHSNPALQNMNPLQAGVQRAGLPQQQPQQQ
LQTPMGAMSPQAQQMNMNHNTMPSQFRDILRRQMMQQQGAGPGIGPGMANHNQFQQPQGI
GYPPQQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQ
PNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQ
PSPHHVSPQTSSPHPGLVAAQAANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDL
GLSSDNADLNSNLSQSTLDIH
NT seq 7266 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaacccgggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggttcactgtttgacctggaa
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggcgat
atcagtcagcttcagacaagtcttggaatagtacaagacgcagcctcgaaacataaacag
ctgtcagaactgctgaggtctggtagctcccctaacctcaacatgggagtcggtggccca
ggccaagtgatggccagccaggcccaacagaacagccctggattaagtttgataaatagc
atggtcaaaagcccaatggcgcagacaggcttgacttctcctaacatggggattggcagt
agtggaccaaatccgggtcctactcagtccccagcaggtatgatgaacagtccagtgaac
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttagct
gcaggcaatggacaagggataatgcccaatcaagtcatgaatggttccattggagcaggc
cggggacggccaaacatgcagtacccaaatgcaggcatgggcaatgctggcagtttattg
actgagccactacagcagggctctcctcagatgggaggacaaccaggattgagaggcccc
caaccacttaagatgggaatgatgaacaatcccagtccttatggttcaccatacactcaa
aattctggacagcagattggagcaagtggccttggtctccaaattcagacaaagactgtt
ctaccaaataacttatctccatttgcaatggacaaaaaggcagttcctggtgggggaatg
cccagtatgggccagcagcctgccccatccgtccagcagccaggtctggtgactccagtt
gccgcagggatgggttctggagcacacacagctgatccagagaagcgcaagctcatccag
cagcagcttgttctcctcttacacgctcacaagtgccagcgccgggagcaggctaatggg
gaagtgagacagtgcaaccttccccactgccgtaccatgaaaaatgtcctaaaccatatg
acacattgccagtcaggcaaatcctgccaagtggcacattgtgcatcttctcgacaaatc
atttcacactggaaaaattgcacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagcgaaatcaacagtcaattttgactggagcaccagttgggcttggaaac
cctagctctctaggagtggggcagcagtccactcctagtctaagcactgttagtcagatt
gaccccagctctatagagcgagcttacgctgctcttggactaccctatcaagtaaaccag
attccaccacaaccccaggtacaagcaaagaatcaacaaagccagccatctggacagtct
ccccagggcatgcggtctatgaacaacatgagtgctagtcctatgggtgtaaatggaggt
gttggggttcagacgccaaatcttctttctgactccatgttgcattcaactataaattct
caaaacccaatgatgagtgaaaatgccagtgtagcctccctgggtcctttgccaacagca
gctcagccatctagtactggaattcgaaaacagtggcatgaagatattactcaggatctt
cgaaaccaccttgttcataaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagaccgacggatggaaaatcttgttgcatatgctcgtaaagtagaaggggacatg
tatgaatctgcaaacaatagagcggaatactatcacctcctagccgagaagatctataag
atccagaaggaactagaagagaaacgaaggactagactacagaaacagaacatgctacca
aatgctcctggcatgggtccagtgcctatgaatactgggtcgaacatggggcagcaacca
acaggaatgactaccaatggtcctgtacctgacccgtctatgatccgtggcagtgtgccg
aaccacatgatgcctcggatgactccacagcctggtttgaatcaatttgggcagatgaat
atgccacagccccctattggacctcggcaaccctctcctcttcagcaccatggacaattg
gctcagtctgggtcactcaatccgcctatgggctatggacctcgcatgcagcaggcttcc
ggccagaaccagttcctctcccagactcagtttacatcccaaggaatgaatgtaacaaac
atgcctttggctccatccagcggtcaagtaccagtgtctcaagcacaaatgtccagttct
tcttgcccagtgaactctcctgtaatgcctccagggtctcaagggagccacattcactgt
cctactctgcctcaacaagctcatcagaattcaccttctcctgttcctagccgcacccct
actcctcatcatacccccccaagcatagggactcaaccaccaccagcaacagcaatccca
ccacctgttcctacacctcctgccataccacctggaccacagcccccgtctctgcatccc
tcatctagacaaacacctacaccaccaacacatctgcctccccaagtgcagccttcactt
cctgctgctccttctgctgaccagtcccagcaacagcctcggtcacagcagagcacagca
gtttctgttcctaccccaacagcaccattgctgcctcctcagccttccactccgctttct
cagccagctgtgagcattgaaggccaggtatcaaaccctccatctactagtagcacagaa
gtgaattctcagactattcctgagaagcagccttcacaggaagtgaaaatggaggctaaa
atggaggtggagcagccagaaccagcagatactcaacctgatgatacaaaggaggctaaa
gctgaggatgttaaagtagaacctacagaaatagaggagagaggccctgagttaaaaact
gaagggaaagaggaggaagaccagccaagcacctctgctacccagtcctccccagctcct
ggacagtcgaagaagaagatgttcaaaccagaagagttacggcaggctctgatgccaaca
ttggaggctctttaccggcaggacccggagtctcttccctttcgtcagcctgtggacccg
cagcttctaggaatccctgattactttgatattgtgaagagccccatggatctttctaca
atcaagaggaagttagatactggacaataccaagagccctggcaatatatagatgatatt
tggcttatgttcaacaatgcctggttatataaccgtaaaacttcaagggtatacaaatac
tgctccaaactttctgaagtatttgaacaagaaattgaccctgtcatgcaaagccttgga
tactgttgtggcagaaagttggagttttctccacagactctatgttgctatgggaaacaa
ttatgcacaatcccccgtgatgctacttactacagttaccagaacaggtatcatttctgt
gagaagtgtttcaatgaaatccaaggggagagcgtttctttgggtgatgacccttcccaa
cctcagactacaataaataaagaacagttttccaagagaaaaaatgacacactggatcct
gaactgtttgttgagtgcacagagtgtggaagaaagatgcaccagatctgtgtccttcac
cacgaaatcatctggccatctgggtttgtctgtgatggctgtttaaagaaaactgcacga
actaggaaagaaaataagttttctgctaaaagattgccatctaccagacttgggaccttt
ctggagaatcgagtgaatgactttctgaggcgacaaaatcaccctgaatcaggagaggtc
actgttcgggttgttcatgcttctgacaaaactgtggaggtgaaaccaggcatgaaagca
aggtttgtagatagtggagagatggcagaatcttttccataccgaacaaaggccctgttt
gcctttgaagaaattgatggtgttgacttgtgtttcttcggcatgcacgttcaggaatat
ggctctgactgcccccctcccaaccagaggagggtatacatatcttacctcgatagtgtt
catttcttccgtcctaaatgcttgcggactgcagtctatcatgaaattctaattggatat
ttggaatatgtcaagaaattaggagcactgactgctcatttagaggtcctgagttcaatt
cccagcaaccatagggtggctcacaaccatctgtaatgggaggatctgatgccttcttct
ggtttctgaagacagctacagtgtacttacagacataaataaacctttataaaagaaaaa
attttaatcctggggatttttttacaggatattttaaaacaagctactgaagatcgatta
acaagtgcaaaggaactaccctactttgaaggtgatttctggcccaatgttctggaagaa
agcatcaaggagcttgaacaggaagaggaagagaggaaacgggaagagaataccagcaac
gagagtactgatgtaacaaaaggagacagcaaaaatgctaagaagaagaataacaagaaa
accagcaaaaacaagagcagcctgagtaggggcaataagaagaagcctggtatgcccaat
gtgtctaatgacctttctcagaaactgtatgccaccatggaaaagcataaagaggtcttc
tttgtgatccgcctcatcgcttgtcctgctcccaattccctgcctcccattgttgatcct
gaccctctcatcccctgtgacctgatggacggcagagatgcattcctcacccttgcaagg
gacaagcacctggaattctcttcacttcgaagagcccagtggtctaccatgtgcatgctg
gtggagctccatacacagagtcaggatcgctttgtctacacctgcaacgagtgcaagcac
cacgtggagacacgctggcattgcactgtgtgtgaggattatgacctgtgcatcacttgt
tataacactaaaaatcatgaccacaaaatggagaaactaggcctcggcttggatgatgag
agcaataaccagcaagctgcagctacccagagcccaggagactcccgccgcctgagcatc
caacgctgcatccagtctctggtgcatgcctgtcagtgccgcaacgccaactgctccctg
ccttcctgccagaagatgaagagggttgtgcagcacaccaaaggctgcaaacggaaaacc
aatggtggatgccccatttgcaaacagcttattgccctctgctgctatcatgccaagcac
tgccaggagaacaagtgcccagtgccattctgcctcaacatcaagcaaaagctccggcag
caacagctgcagcaccggctccaacaggctcagatgctccgcaggaggatggccagcatg
caacgaactggtgtggcagggcagcagcagggcctgccgtccccaactcctgctactcca
actacccctactggccaacagccagccaccccacagacaccccagccccaacccacctct
caaccacagcccactcctcccaacaacatgacaccctacttacccaggactcagactact
ggccctgtgtcccagggtaaggcagcaggccaggtgaccccacccaccccacctcagact
gctcaggccccccttccagggcctccacctgcagcagtagaaatggcaatgcaaattcag
agggcagcagagacacagcgccagatggcccatgtacagattttccaaaggccaatccag
caccagataccccagatgacacccatggcccctatgggcatgaacccacctcctatggcc
agaggtcctggtgggcatttggatccaggaataggtccagcaggaatgcagcaacagccg
ccttgggcccaaggaggaatgcctcagccccagcagatgcagtcagggatgccaaggcca
gccatgatgtcagtggcccagcatggtcagcctttgaacatggctccacaaccaggattg
ggccaagtgggtgtgagccctctcaagccaggcactgtgtctcaacaagccttacaaagc
cttttgcggactctcaggtctcccagttctcccttacagcagcaacaggtgcttagtatc
cttcatgccaacccccaactgttggctgcattcatcaagcagcgggctgccaagtatgcc
aaccctaattcacagcctctccctggacagcctggcatgccccagggacagccagggctg
cagccacctaccatgcctggccagcaaggtgtccactccaacccagccttgcagaacatg
aatcctctgcaggcaggtgtccagagagctggcctgccccagcagcagccacagcagcag
ctccagacacccatgggagcaatgagtccccaagctcagcaaatgaacatgaatcacaat
accatgccttcgcagttcagagacatcttaagacggcagatgatgcaacagcagggagca
gggccaggaatcggccctggaatggccaaccacaaccagttccagcagccccaaggaatt
ggctatccaccccagcagcagcagcaacagcagcgaatgcagcatcacatgcagcaaatg
cagcaaggaaatatgggacaaatgggtcagcttccccaggctctgggggctgaggcagga
gccagtctacaggcctatcagcagcgacttcttcaacaacagatggggtctcctgctcag
cccaatcctatgagcccacagcagcacatgctcccaaatcaggcacagtccccacaccta
caaggtcaacaaatccctaattctctctccaatcaagtgcgctctccccaacctgtccct
tctcctcgaccacagtctcagcccccccattccagcccatctccgaggatgcagcctcag
ccttctccacaccatgtttctccacagaccagttccccacatcctggactggtagctgcc
caggctgccaaccctatggaacaagggcattttgctagcccagaccagaattcaatgctt
tcacagctcgctagcaatccaggcatggcaaacctccacggggcaagtgccacggacctg
ggactgagcagcgataatgcagacttgaattcaaacctctcacagagtacactagacata
cactag

KEGG   Mus caroli (Ryukyu mouse): 110311224
Entry
110311224         CDS       T05910                                 

Gene name
Crebbp
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04024  cAMP signaling pathway
mcal04066  HIF-1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04110  Cell cycle
mcal04310  Wnt signaling pathway
mcal04330  Notch signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04520  Adherens junction
mcal04630  JAK-STAT signaling pathway
mcal04720  Long-term potentiation
mcal04916  Melanogenesis
mcal04919  Thyroid hormone signaling pathway
mcal04922  Glucagon signaling pathway
mcal04935  Growth hormone synthesis, secretion and action
mcal05016  Huntington disease
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05203  Viral carcinogenesis
mcal05206  MicroRNAs in cancer
mcal05211  Renal cell carcinoma
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110311224 (Crebbp)
   04330 Notch signaling pathway
    110311224 (Crebbp)
   04350 TGF-beta signaling pathway
    110311224 (Crebbp)
   04630 JAK-STAT signaling pathway
    110311224 (Crebbp)
   04066 HIF-1 signaling pathway
    110311224 (Crebbp)
   04068 FoxO signaling pathway
    110311224 (Crebbp)
   04024 cAMP signaling pathway
    110311224 (Crebbp)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110311224 (Crebbp)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110311224 (Crebbp)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110311224 (Crebbp)
   04935 Growth hormone synthesis, secretion and action
    110311224 (Crebbp)
   04919 Thyroid hormone signaling pathway
    110311224 (Crebbp)
   04916 Melanogenesis
    110311224 (Crebbp)
  09156 Nervous system
   04720 Long-term potentiation
    110311224 (Crebbp)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311224 (Crebbp)
   05206 MicroRNAs in cancer
    110311224 (Crebbp)
   05203 Viral carcinogenesis
    110311224 (Crebbp)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110311224 (Crebbp)
   05215 Prostate cancer
    110311224 (Crebbp)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110311224 (Crebbp)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110311224 (Crebbp)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110311224 (Crebbp)
   05161 Hepatitis B
    110311224 (Crebbp)
   05164 Influenza A
    110311224 (Crebbp)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110311224 (Crebbp)
   05165 Human papillomavirus infection
    110311224 (Crebbp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110311224 (Crebbp)
   03036 Chromosome and associated proteins [BR:mcal03036]
    110311224 (Crebbp)
   03029 Mitochondrial biogenesis [BR:mcal03029]
    110311224 (Crebbp)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     110311224 (Crebbp)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    110311224 (Crebbp)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    110311224 (Crebbp)
Mitochondrial biogenesis [BR:mcal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    110311224 (Crebbp)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 110311224
NCBI-ProteinID: XP_021040128
Ensembl: MGP_CAROLIEiJ_G0020398
UniProt: A0A6P5RBL2
LinkDB
Position
16
AA seq 2444 aa
MAENLLDGPPNPKRAKLSSPGFSANDNTDFGSLFDLENDLPDELIPNGELSLLNSGNLVP
DAASKHKQLSELLRGGSGSSINPGIGNVSASSPVQQGLGGQAQGQPNSTNMASLGAMGKS
PLNQGDSSTPNLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNANF
NQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAMQGTTSSVLAE
TLTQVSPQMAGHAGLNTAQAGGMTKMGMTGTTSPFGQPFSQTGGQQMGATGVNPQLASKQ
SMVNSLPAFPTDIKNTSVTTVPNMSQLQTSVGIVPTQAIATGPTADPEKRKLIQQQLVLL
LHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWKN
CTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGAGQQNATSLSNPNPIDPSSM
QRAYAALGLPYMNQPQTQQLQPQVPGQQPAQPPAHQQMRTLNALGNNPMSIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGSLSTIPTAAPPSSSGVRKGWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPASGAQPPVIPPAQSVRPPNGPLPLPVNRMQVSQG
MNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMASVPGMAISPSRMPQPPNMMGTHA
NNIMAQAPTQNQFLPQNQFPSSSGAMSVNSVGMGQPAAQAGVSQGQVPGGALPNPLNMLA
PQASQLPCPPVTQSPLHPTPPPASTAAGMPSLQHPTAPGMTPPQPAAPTQPSTPVSSGQT
PTPTPGSVPSAAQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPPG
TPLSQAAASIDNRVPTPSSVTSAETSSQQPGPDVPMLEMKTEVHTDEAEPDPTESKGEPR
SETMEEDLQGSSQVKEETDATEQKSEPMEVEEKKPAVKVEAKEEEESSANDTASQSTSPS
QPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI
KRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLGY
CCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQP
QTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGRP
RKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKSR
FVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSIH
FFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPKR
LQEWYKKMLDKAFAERIINDYKDIFKQANEDRLTSAKELPYFEGDFWPNVLEESIKELEQ
EEEERKKEESTAASETPEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDLS
QKLYATMEKHKEVFFVIHLHAGPVISTQPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEF
SSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKSH
THKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKM
KRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQHR
LQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVNMSP
AGFPNVARTQPPTIVSAGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRANIN
NGMPPGRAGMGTPGSQMTPVGLNVPRPNQVSGPVMSSMPPGQWQQAPIPQQQPMPGMPRP
VMSMQAQAAVAGPRMPNVQPPRSISPSALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMA
AFIKQRTAKYVANQPGMQPQPGLQSQPGMQPQPGMHQQPSLQNLNAMQAGVPRPGVPPPQ
PAMGGLNPQGQALNIMNPGHNPNMANMNPQYREMVRRQLLQHQQQQQQQQQQQQQQQQQN
SASLAGGMAGHSQFQQPQGPGGYAPAMQQQRMQQHLPIQGSSMGQMAAPMGQLGQMGQPG
LGADSTPNIQQALQQRILQQQQMKQQIGSPGQPNPMSPQQHMLSGQPQASHLPGQQIATS
LSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSMDQG
HLGNPEQSAMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7335 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctcgccc
ggcttctccgcgaatgacaacacagattttggatcattgtttgacttggaaaatgatctt
cctgatgagctgatccccaatggagaattaagccttttaaacagtgggaaccttgttcca
gatgctgcgtccaaacataaacaactgtcagagcttcttagaggaggcagcggctctagc
atcaacccagggataggcaatgtgagtgccagcagccccgtgcaacagggccttggtggc
caggctcaggggcagccgaacagtacaaacatggccagcttaggtgccatgggcaagagc
cctctgaaccaaggagactcatcaacacccaacctgcccaaacaggcagccagcacctct
gggcccactccccctgcctcccaagcactgaatccacaagcacaaaagcaagtagggctg
gtgaccagtagtcctgccacatcacagactggacctgggatctgcatgaatgctaacttc
aaccagacccacccaggccttctcaatagtaactctggccatagtttaatgaatcaggct
caacaagggcaagctcaagtcatgaatggatctcttggggctgctggaagaggaagggga
gctggaatgccctaccctgctccagccatgcaggggaccacaagcagtgtgctggcggag
accttgacacaggtttccccacaaatggctggccatgctggactaaatacagcacaggca
ggaggcatgaccaagatgggaatgactggtaccacaagtccatttggacaaccctttagt
caaactggagggcagcagatgggagccactggagtgaacccccagttagccagcaaacag
agcatggtcaatagtttgcctgcttttcctacagatatcaagaatacttcagtcaccact
gtgccaaatatgtcccagttgcaaacatcagtgggaattgtgcccacacaagcaattgca
acaggccccacagcagaccctgaaaaacgcaaactgatacagcagcagctggttctactg
cttcatgcccacaaatgtcagagacgagagcaagcgaatggagaggttcgagcctgttct
ctcccacactgtcgaaccatgaaaaacgttttgaatcacatgacacattgtcaggctggg
aaagcctgccaagttgcccattgtgcatcttcacgacaaatcatctctcattggaagaac
tgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcgaaac
caacaaaccatcctgggatctccagctagtggaattcaaaacacaattggttctgttggt
gcagggcaacagaatgccacttccttaagtaacccaaatcccatagaccccagttccatg
cagcgggcctatgctgccctaggactcccctacatgaaccagcctcagacgcagcagctg
cagcctcaggttcctggccagcaaccagcacagcctccagcccaccagcagatgaggact
ctcaatgccctaggaaacaaccctatgagtattccagcaggaggaataacaacagatcaa
cagccaccaaacttgatttcagaatcagctcttccaacttccttgggggctaccaatcca
ctgatgaatgatggttcaaactctggtaacattggaagcctcagcacgatacccacagca
gcgcctccttccagcagtggtgttcgaaaaggctggcatgaacatgtgactcaggaccta
cggagtcatctagtccataaactcgttcaagccatcttcccaactccagaccctgcagct
ctgaaagatcgccgcatggagaacctggttgcctatgctaagaaagtggagggagacatg
tatgagtctgctaatagcagggatgaatactatcatttattagcagagaaaatctataaa
atacaaaaagaactagaagaaaagcggaggtcacgtttacataaacaaggcatcctgggt
aaccagccggctttaccagcttctggggctcagccccctgtgatcccaccagcccagtct
gtaagacctccaaatgggcccctgcctttgccagtgaatcgcatgcaggtttctcaaggg
atgaattcatttaacccaatgtccctgggaaacgtccagttgccacaggcacccatggga
cctcgtgcagcctctcctatgaaccactctgtgcagatgaacagcatggcctcagttccg
ggtatggccatttctccttcacggatgcctcagcctccaaatatgatgggcacccatgcc
aacaacattatggcccaggcacctactcagaaccagtttctgccacagaaccagtttcca
tcatccagtggggcaatgagtgtgaacagtgtgggcatggggcagccagcagcccaggca
ggtgtttcacagggccaggtacctggaggtgctctccctaaccctctgaacatgctggca
ccccaggccagccagctgccttgcccaccagtgacacagtcaccattgcacccgactcca
cctcctgcttccacagctgctggcatgccctctctccaacatccaacggcaccagggatg
acccctccccagccagcagctcccactcagccatccactcctgtgtcatctgggcagact
cctaccccaactcctggctcagtgcccagcgctgcccaaacacagagtacccctacagtc
caggcagcagcacaggctcaggtgaccccacagcctcagaccccagtgcagccaccatct
gtggctactcctcagtcatcacagcagcaaccaacgcctgtgcatactcagcctcctggc
acaccgctttctcaggcagcagccagcattgataatagagtccctactccctcctctgtg
accagtgctgaaaccagttcccagcagccaggacctgatgtgcccatgctggaaatgaag
acagaggtgcacacagatgaagctgagcctgatcctactgaatccaagggggaacctcgg
tctgagacgatggaagaggatttacaaggttcttcccaagtaaaagaagagacagatgcg
acagagcagaagtcagagccaatggaagtagaagaaaagaaacctgcagtaaaagtggaa
gctaaagaggaagaagagagcagtgcgaacgacacagcctcacagtcaacatctccttcc
cagccacgcaaaaaaatctttaaacccgaggagctccgccaggcccttatgccaactctg
gaagcgctctaccgacaggacccagagtccttgcctttccgtcagcctgtagatcctcag
ctcctaggaatcccagattattttgatatagtgaagaatcctatggacctttctaccatc
aaacgaaagctggacacagggcaatatcaagaaccctggcagtatgtggatgatgtctgg
cttatgttcaacaatgcgtggctatataatcgtaaaacgtcccgtgtatataaattttgc
agcaaacttgcagaggtctttgaacaagaaattgaccctgtcatgcagtctcttggatat
tgctgtggacgaaagtatgagttctccccacagactttgtgctgttatggaaagcagctg
tgtacaattcctcgtgatgcagcctactacagctatcagaataggtatcatttctgtgag
aagtgtttcacagagatccagggcgagaatgtgaccctgggtgacgacccttcccaacct
cagacgacaatttccaaggatcaatttgaaaagaagaaaaatgataccttagatcctgaa
ccttttgttgactgcaaagagtgtggccggaagatgcatcaaatttgtgttctacactat
gacatcatttggccttcaggttttgtgtgtgacaactgtttgaagaaaactggcagacct
cggaaagaaaacaaattcagtgctaagaggctgcagaccacacgattgggaaaccacttg
gaagaccgagtgaataagtttttgcggcgccagaatcaccctgaagctggggaggttttt
gtcagagtggtggccagctcagacaagactgtggaggtcaagccgggcatgaagtcgcgg
tttgtggattctggagagatgtcagaatctttcccatatcgtaccaaagcactcttcgct
tttgaggagatcgatggagtcgatgtgtgcttttttgggatgcatgtgcaagaatacggc
tctgattgccccccaccaaatacaaggcgtgtatacatatcttatctggacagtattcat
ttcttccggccccgctgtctccggacagctgtttaccatgagatcctcatcggatatcta
gagtatgtgaagaaattggggtatgtgacaggacatatttgggcctgtcccccaagtgaa
ggagatgactatatctttcattgccacccccctgaccagaaaatccccaaaccaaaacga
ctacaggagtggtacaagaagatgctggacaaggcgttcgcagagaggatcattaacgac
tataaggacatcttcaaacaagcgaacgaagacaggctcacaagtgccaaggagttgccc
tattttgaaggagatttctggcctaatgtgttggaagaaagcattaaggaactagaacaa
gaagaagaagaaaggaaaaaagaagagagtactgcagcgagtgagactcctgagggcagt
cagggtgacagcaaaaatgcaaagaaaaagaacaacaagaagaccaacaaaaacaaaagc
agcattagccgcgccaacaagaagaagcccagcatgcccaatgtttccaatgacctgtcg
cagaagctgtatgccaccatggagaagcacaaggaggtgttctttgtgattcatctgcat
gctgggcctgttatcagcacccagccccccatcgtggaccctgatcctctgcttagctgt
gacctcatggatggccgtgatgccttcctcaccctggccagggacaagcactgggaattc
tcttccttacgccgctccaaatggtccactctgtgcatgctggtggagctgcacacacag
ggccaggaccgctttgtttatacctgcaatgagtgcaaacaccatgtggaaacacgctgg
cactgcactgtgtgtgaggactatgacctttgtatcaattgctacaacacaaagagccac
acccataagatggtgaagtgggggctaggcctagatgatgagggcagcagtcagggtgag
ccacagtccaagagcccccaggaatcccggcgtctcagcatccagcgctgcatccagtcc
ctggtacatgcctgccagtgtcgcaatgccaactgctcactgccgtcttgccagaagatg
aagcgagtcgtgcagcacaccaagggctgcaagcgcaagactaatggaggatgcccagtg
tgcaagcagctcattgctctttgctgctaccacgccaaacactgccaagaaaataaatgc
cctgtgcccttctgcctcaacatcaaacataagctccgccagcagcagatccagcatcgc
ctgcagcaggctcagctcatgcgccggcgaatggcaaccatgaacacccgcaatgtgcct
cagcagagtttgccttctcctacctcagcaccacccgggactcctacacagcagcccagc
acaccccaaacaccacagcccccagcccagcctcagccttcacctgttaacatgtcacca
gctggcttccctaatgtagcccggactcagcccccaacaatagtgtctgctgggaagcct
accaaccaggtgccagctcccccaccccctgcccagcccccacctgcagcagtagaagca
gcccggcaaattgaacgtgaggcccagcagcagcagcacctataccgagcaaacatcaac
aatggcatgcccccagggcgtgcaggtatggggaccccaggaagccaaatgactcctgtg
ggcctgaatgtgccccgtcccaaccaagtcagtgggcctgtcatgtctagtatgccacct
gggcagtggcagcaggcacccatccctcagcagcaaccgatgccaggcatgcccaggcct
gtaatgtccatgcaggcccaggcagcagtggctgggccacggatgcccaatgtgcagcca
ccaaggagcatctcgccaagtgccctgcaagacctgcttcggaccctaaagtcacccagc
tctcctcagcagcagcagcaggtgctgaacatccttaaatcaaacccacagctaatggca
gctttcatcaaacagcgcacagccaagtatgtggccaatcagcctggcatgcagccccag
cccggacttcaatcccagcctggtatgcagccccagcctggcatgcaccagcagcctagt
ttgcaaaacctgaacgcaatgcaagctggtgtgccacggcctggtgtgcctccaccacaa
ccagcaatgggaggcctgaacccccagggacaagctctgaacatcatgaacccaggacac
aaccccaacatggcaaacatgaatccacagtaccgagaaatggtgaggagacagctgcta
cagcaccagcagcagcagcagcagcagcagcaacagcagcagcagcagcaacaacaaaat
agtgccagcttggccgggggcatggcgggacacagccagttccagcagccacaaggacct
ggaggttatgccccagccatgcagcagcaacgcatgcaacagcacctccccatccagggc
agctccatgggccagatggctgctccaatgggacaacttggccagatggggcagcctggg
ctaggggcagacagcacccctaatatccagcaggccctgcagcaacggattctgcagcag
cagcagatgaagcaacaaattgggtcaccaggccagccgaaccccatgagcccccagcag
cacatgctctcaggacagccacaggcctcacatctccctggccagcagatcgccacatcc
cttagtaaccaggtgcgatctccagcccctgtgcagtctccacggccccaatcccaacct
ccacattccagcccgtcaccacggatacagccccagccttcaccacaccatgtttcaccc
cagactggttcccctcaccctggactcgcagtcaccatggccagctccatggatcaggga
cacctggggaaccctgaacagagtgcaatgcttccccagctgaacacccccaacaggagc
gcactgtccagtgaactgtccctggttggtgacaccacgggggacacactagaaaagttt
gtggagggtttgtag

DBGET integrated database retrieval system