KEGG   Mus caroli (Ryukyu mouse): 110310427
Entry
110310427         CDS       T05910                                 

Gene name
Ppara
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03320  PPAR signaling pathway
mcal04024  cAMP signaling pathway
mcal04920  Adipocytokine signaling pathway
mcal04922  Glucagon signaling pathway
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    110310427 (Ppara)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    110310427 (Ppara)
   04920 Adipocytokine signaling pathway
    110310427 (Ppara)
   03320 PPAR signaling pathway
    110310427 (Ppara)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110310427 (Ppara)
   04931 Insulin resistance
    110310427 (Ppara)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110310427 (Ppara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110310427 (Ppara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mcal03310]
    110310427 (Ppara)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110310427 (Ppara)
Nuclear receptors [BR:mcal03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   110310427 (Ppara)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110310427
NCBI-ProteinID: XP_021039032
Ensembl: MGP_CAROLIEiJ_G0020129
UniProt: A0A6P5R5T7
LinkDB
Position
15
AA seq 468 aa
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggtggacacagagagccccatctgtcctctctccccactggaggcagatgacctggaa
agtcccttatctgaagaattcttacaagagatgggaaacattcaagagatttctcagtcc
atcggtgaggagagctctggaagctttggtttcgcagactaccagtacttaggaagctgt
ccgggctccgagggctctgtcatcacagacaccctctctccagcttccagcccttcctca
gtcagctgccccgtgatccccgccagcacggacgagtcccccggcagtgccctgaacatc
gagtgtcgaatatgtggggacaaggcctcaggataccactacggagtacacgcatgtgaa
ggctgtaagggcttctttcggcgaactattaggctaaagctggtgtacgacaagtgtgat
cggagctgcaagattcagaaaaagaaccggaacaaatgccagtactgccgttttcacaag
tgcctgtctgtcgggatgtcacacaatgcaattcgctttggaagaatgccaagatccgaa
aaagcaaaactgaaagcagaaattcttacttgtgaacacgacctgaaagattcggaaact
gcagacctcaaatctctgggcaagagaatccatgaagcctacctaaagaacttcaacatg
aacaaggtcaaagcccgggtcatacttgcgggaaagaccagcaacaacccgccttttgtc
atacatgacatggagaccttgtgtatggccgagaagacgcttgtggccaagatggtggcc
aacggcgtcgaagacaaggaggcagaggtccgattcttccactgctgccagtgcatgtcc
gtggagaccgtcacagagctcacagaatttgccaaggctatcccaggctttgcaaacttg
gacttgaacgaccaagtcaccttgctaaagtacggtgtgtatgaagccatcttcacgatg
ctgtcctccttgatgaacaaagacgggatgctgatcgcgtacggcaatggcttcatcaca
cgtgagttcctaaaaaacctgaggaagccgttctgtgacatcatggaacccaagtttgac
ttcgctatgaagttcaatgccttagaactggatgacagtgacatttccctgtttgtggct
gctataatttgctgtggagatcggcctggccttctaaacataggctacattgagaagttg
caggaggggattgtgcacgtgcttaagctccacctgcagagcaaccatccggatgacacc
ttcctcttcccaaagctccttcaaaaaatggtggaccttcggcagctggtcacggagcat
gcgcagctcgtacaggtcatcaagaagaccgagtccgacgcagcactgcacccactgttg
caagagatctacagagacatgtactga

DBGET integrated database retrieval system