KEGG   Mus caroli (Ryukyu mouse): 110310464
Entry
110310464         CDS       T05910                                 

Gene name
Rbx1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03420  Nucleotide excision repair
mcal04066  HIF-1 signaling pathway
mcal04110  Cell cycle
mcal04114  Oocyte meiosis
mcal04120  Ubiquitin mediated proteolysis
mcal04141  Protein processing in endoplasmic reticulum
mcal04310  Wnt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04710  Circadian rhythm
mcal05170  Human immunodeficiency virus 1 infection
mcal05200  Pathways in cancer
mcal05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110310464 (Rbx1)
   04120 Ubiquitin mediated proteolysis
    110310464 (Rbx1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    110310464 (Rbx1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110310464 (Rbx1)
   04350 TGF-beta signaling pathway
    110310464 (Rbx1)
   04066 HIF-1 signaling pathway
    110310464 (Rbx1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110310464 (Rbx1)
   04114 Oocyte meiosis
    110310464 (Rbx1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110310464 (Rbx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310464 (Rbx1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    110310464 (Rbx1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110310464 (Rbx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mcal04121]
    110310464 (Rbx1)
   03400 DNA repair and recombination proteins [BR:mcal03400]
    110310464 (Rbx1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     110310464 (Rbx1)
Ubiquitin system [BR:mcal04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   110310464 (Rbx1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     110310464 (Rbx1)
   ECV complex
     110310464 (Rbx1)
   Cul3 complex
     110310464 (Rbx1)
   Cul4 complex
     110310464 (Rbx1)
   Cul7 complex
     110310464 (Rbx1)
   Cul9 complex
     110310464 (Rbx1)
DNA repair and recombination proteins [BR:mcal03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      110310464 (Rbx1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      110310464 (Rbx1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 110310464
NCBI-ProteinID: XP_021039109
Ensembl: MGP_CAROLIEiJ_G0020053
UniProt: A0A6P5R5Y3
LinkDB
Position
15
AA seq 108 aa
MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcggcgatggatgtggatacccccagcggaaccaacagcggcgcgggcaagaag
cgctttgaagttaaaaagtggaatgcagtggccctctgggcctgggacattgtggttgat
aactgtgccatctgcaggaaccacattatggatctttgtatcgaatgtcaggccaaccag
gcgtcagctacttccgaagagtgtacggttgcatggggcgtctgcaaccatgcttttcat
ttccactgcatctctcgatggctcaaaacgaggcaggtgtgtccgttggacaacagagag
tgggagttccagaagtatgggcattag

DBGET integrated database retrieval system