KEGG   Mus caroli (Ryukyu mouse): 110310583
Entry
110310583         CDS       T05910                                 

Gene name
Myc
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04010  MAPK signaling pathway
mcal04012  ErbB signaling pathway
mcal04110  Cell cycle
mcal04151  PI3K-Akt signaling pathway
mcal04218  Cellular senescence
mcal04310  Wnt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04390  Hippo signaling pathway
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04630  JAK-STAT signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal05132  Salmonella infection
mcal05160  Hepatitis C
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05200  Pathways in cancer
mcal05202  Transcriptional misregulation in cancer
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05216  Thyroid cancer
mcal05219  Bladder cancer
mcal05220  Chronic myeloid leukemia
mcal05221  Acute myeloid leukemia
mcal05222  Small cell lung cancer
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
mcal05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110310583 (Myc)
   04012 ErbB signaling pathway
    110310583 (Myc)
   04310 Wnt signaling pathway
    110310583 (Myc)
   04350 TGF-beta signaling pathway
    110310583 (Myc)
   04390 Hippo signaling pathway
    110310583 (Myc)
   04630 JAK-STAT signaling pathway
    110310583 (Myc)
   04151 PI3K-Akt signaling pathway
    110310583 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110310583 (Myc)
   04218 Cellular senescence
    110310583 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310583 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    110310583 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110310583 (Myc)
   05202 Transcriptional misregulation in cancer
    110310583 (Myc)
   05206 MicroRNAs in cancer
    110310583 (Myc)
   05205 Proteoglycans in cancer
    110310583 (Myc)
   05230 Central carbon metabolism in cancer
    110310583 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110310583 (Myc)
   05225 Hepatocellular carcinoma
    110310583 (Myc)
   05226 Gastric cancer
    110310583 (Myc)
   05216 Thyroid cancer
    110310583 (Myc)
   05221 Acute myeloid leukemia
    110310583 (Myc)
   05220 Chronic myeloid leukemia
    110310583 (Myc)
   05219 Bladder cancer
    110310583 (Myc)
   05213 Endometrial cancer
    110310583 (Myc)
   05224 Breast cancer
    110310583 (Myc)
   05222 Small cell lung cancer
    110310583 (Myc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110310583 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110310583 (Myc)
   05161 Hepatitis B
    110310583 (Myc)
   05160 Hepatitis C
    110310583 (Myc)
   05163 Human cytomegalovirus infection
    110310583 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110310583 (Myc)
   05169 Epstein-Barr virus infection
    110310583 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110310583 (Myc)
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110310583 (Myc)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    110310583 (Myc)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     110310583 (Myc)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 110310583
NCBI-ProteinID: XP_021039308
Ensembl: MGP_CAROLIEiJ_G0019833
UniProt: A0A6P5QX83
LinkDB
Position
15
AA seq 439 aa
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQ
DLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtgaacttcaccaacaggaactatgacctcgactacgactccgtgcag
ccctatttcatctgcgacgaggaagagaatttctatcaccagcaacagcagagcgagctg
cagccgcccgcgcccagtgaggatatctggaagaaattcgagctgcttcccaccccgccc
ctgtccccgagccgccgctccgggctctgctctccatcctatgttgcggtcgctacgtcc
ttctccccaagggaagacgatgacggcggcggtggcaacttctccaccgccgatcagctg
gagatgatgaccgagttacttggaggagacatggtgaaccagagcttcatctgcgatcct
gacgacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggtttctcg
gccgctgccaagctggtctcggagaagctggcctcctaccaggctgcgcgcaaagacagc
accagcctgagccccgcccgcgggcacagcgtctgctccacctccagcctgtacctgcag
gacctcaccgccgccgcgtccgagtgcattgacccctcagtggtctttccctacccgctc
aacgacagcagctcgcccaaatcctgtacctcttccgattccaccgccttctctccttcc
tcggactcgctgctgtcctccgagtcctccccacgggccagccctgagcccctagtgctg
catgaggagacaccgcccaccaccagcagcgactctgaagaagagcaagaagatgaggaa
gaaattgatgtggtgtctgtggagaagaggcaaacccctgccaagaggtcggagtcgggc
tcatctccatcccgaggccacagcaaacctccgcacagcccactggtcctcaaaaggtgc
cacgtctccactcaccagcacaactacgcagcacccccctccacaaggaaggactatcca
gctgccaagagggccaagttggacagtggcagggtcctgaagcagatcagcaacaaccgc
aaatgctccagccccaggtcctcagacaccgaggaaaacgacaagaggcggacacacaac
gtcttggaacgtcagaggaggaacgagctgaagcgcagcttttttgccctgcgtgaccag
atccctgaattggaaaacaacgaaaaggcccccaaggtagtgatcctcaaaaaagccacc
gcctacatcctgtccattcaagcagatgagcacaagctcacctctgaaaaggacttattg
aggaaacggcgagaacagttgaaacacaaactcgaacagcttcgaaactctggtgcataa

DBGET integrated database retrieval system