KEGG   Mus caroli (Ryukyu mouse): 110310643Help
Entry
110310643         CDS       T05910                                 

Gene name
Ribc2
Definition
(RefSeq) RIB43A-like with coiled-coils protein 2
Organism
mcal  Mus caroli (Ryukyu mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 110310643
NCBI-ProteinID: XP_021039409
Ensembl: MGP_CAROLIEiJ_G0020124
LinkDB All DBs
Position
15
AA seq 377 aa AA seqDB search
MEVAMSKDLQQEANLAKKRYMDLCRQGRIFDARNRIIGGDTQAWDFQVRDQKIKEITDKA
RHEAFAAEMKHNDKVMCIAHDREQRHRKQLCRAINDFQQNFQKPETRREFDLSDPLALQK
ELPARVSDNDMRNTISGMQKFMGEDLNFQERRRFQKEQSREWFLQQHGEREKARADHILA
ERLHTQARLKFDETARELLKLEGSTRKEICAAVKAFNKNQVVELTERKRQEKQQEQEDNM
TEITNLLHGGLLSENPRQVASSFGPHRVVLDHWKGMNREQLEEIWFTQKQQIQEKLRLQE
EERQHSMDWDLRRIRKAHASLLHERQQQRLLREQRRALDCSNLNLARQQYLQKKQMNTAS
SSQPTEDYFSQFNTRSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagcgatgtctaaggacctacaacaggaggccaacctagccaagaagcggtac
atggacctgtgcaggcagggacggatcttcgacgccaggaacaggatcattgggggagac
acacaagcctgggattttcaagtccgtgaccagaagataaaagaaataactgacaaagct
aggcatgaagcctttgctgctgaaatgaagcacaatgacaaagtcatgtgcatcgcacat
gaccgggaacagaggcacaggaaacagctgtgtagagcgatcaatgacttccagcagaac
tttcagaagccagaaactcgacgtgagtttgatctttctgaccccctggccctccagaaa
gagcttccggcccgagtttcagacaatgacatgcggaacaccatatcaggaatgcagaag
ttcatgggagaggatttaaacttccaagagaggaggaggttccaaaaggaacagagcaga
gaatggtttctgcagcagcatggggaaagggagaaagcccgtgctgaccacatactggca
gaacgcctccacactcaggcaagactcaagtttgatgaaacagcccgagagttgctgaag
ctggaaggctccaccaggaaggaaatctgcgcagccgtgaaagcgttcaataagaaccag
gttgtggagttgacagaaagaaagaggcaagagaaacaacaagaacaagaagacaacatg
accgagatcaccaacctgctgcatgggggcctgctttctgagaaccctcggcaggtggcc
agctcctttgggcctcaccgtgtggtccttgaccactggaagggcatgaaccgagagcag
ctagaggagatctggttcacgcagaagcagcaaatccaggagaagctgaggcttcaggag
gaagaacgccagcacagcatggactgggatctgcgcaggatccggaaggctcatgccagc
ctgctgcatgagcggcagcagcaacgcttgctgcgggagcagcgcagggccctggactgc
agcaacctcaacctggccaggcagcagtacttacagaaaaaacaaatgaatacagcctcc
tcaagccagcccacagaagactatttctcacagtttaatacaaggagccgctga

DBGET integrated database retrieval system