KEGG   Mus caroli (Ryukyu mouse): 110310902
Entry
110310902         CDS       T05910                                 

Gene name
Mapk12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04015  Rap1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05205  Proteoglycans in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110310902 (Mapk12)
   04015 Rap1 signaling pathway
    110310902 (Mapk12)
   04370 VEGF signaling pathway
    110310902 (Mapk12)
   04668 TNF signaling pathway
    110310902 (Mapk12)
   04068 FoxO signaling pathway
    110310902 (Mapk12)
   04071 Sphingolipid signaling pathway
    110310902 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110310902 (Mapk12)
   04218 Cellular senescence
    110310902 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310902 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110310902 (Mapk12)
   04613 Neutrophil extracellular trap formation
    110310902 (Mapk12)
   04620 Toll-like receptor signaling pathway
    110310902 (Mapk12)
   04621 NOD-like receptor signaling pathway
    110310902 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    110310902 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    110310902 (Mapk12)
   04660 T cell receptor signaling pathway
    110310902 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    110310902 (Mapk12)
   04659 Th17 cell differentiation
    110310902 (Mapk12)
   04657 IL-17 signaling pathway
    110310902 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    110310902 (Mapk12)
   04670 Leukocyte transendothelial migration
    110310902 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110310902 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    110310902 (Mapk12)
   04917 Prolactin signaling pathway
    110310902 (Mapk12)
   04926 Relaxin signaling pathway
    110310902 (Mapk12)
   04935 Growth hormone synthesis, secretion and action
    110310902 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110310902 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    110310902 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    110310902 (Mapk12)
   04722 Neurotrophin signaling pathway
    110310902 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110310902 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110310902 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    110310902 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110310902 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110310902 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110310902 (Mapk12)
   05020 Prion disease
    110310902 (Mapk12)
   05022 Pathways of neurodegeneration - multiple diseases
    110310902 (Mapk12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110310902 (Mapk12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110310902 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110310902 (Mapk12)
   05135 Yersinia infection
    110310902 (Mapk12)
   05133 Pertussis
    110310902 (Mapk12)
   05152 Tuberculosis
    110310902 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110310902 (Mapk12)
   05161 Hepatitis B
    110310902 (Mapk12)
   05171 Coronavirus disease - COVID-19
    110310902 (Mapk12)
   05163 Human cytomegalovirus infection
    110310902 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110310902 (Mapk12)
   05169 Epstein-Barr virus infection
    110310902 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110310902 (Mapk12)
   05140 Leishmaniasis
    110310902 (Mapk12)
   05142 Chagas disease
    110310902 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310902 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110310902 (Mapk12)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110310902 (Mapk12)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110310902 (Mapk12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like UvrD_C
Other DBs
NCBI-GeneID: 110310902
NCBI-ProteinID: XP_021039727
Ensembl: MGP_CAROLIEiJ_G0020154
UniProt: A0A6P5R599
LinkDB
Position
15
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
ITGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRV
TAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaagacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctactggatgtgttcacacctgatgagtctctggac
gacttcacagacttctacctggtgatgccattcatgggcactgatctgggcaaactcatg
aagcatgagaccctgagtgaagacagaatccagtttcttgtgtatcagatgttgaagggg
ctgaagtatatccatgcggctggtgtcatccacagagacttgaagcctggcaacctggct
gtgaatgaggactgtgagctgaagatcctagactttggccttgccaggcaggcagacagt
gagatgactggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgctacacacagacagtggacatttggtccgttggctgcatcatggcggagatgatt
actgggaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaag
atcacagggacgccccctcctgagtttgttcagaagttacagagtgctgaggccaagaac
tacatggaaggcctccctgagttagaaaagaaggattttgcctctgtcctgaccaacgca
agccctcaggctgtgaatctcctggaaaggatgctggtgctggatgcggaacagcgggtg
acagcagctgaggcgttaacccatccatactttgagtcccttcgggacactgaggatgaa
cccaaggcccagaaatatgacgactcctttgatgatgtagaccgcacccttgaggaatgg
aagcgtgttacttacaaggaagttctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacggctctgtga

KEGG   Mus caroli (Ryukyu mouse): 110310903
Entry
110310903         CDS       T05910                                 

Gene name
Mapk11
Definition
(RefSeq) mitogen-activated protein kinase 11 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04015  Rap1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05205  Proteoglycans in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110310903 (Mapk11)
   04015 Rap1 signaling pathway
    110310903 (Mapk11)
   04370 VEGF signaling pathway
    110310903 (Mapk11)
   04668 TNF signaling pathway
    110310903 (Mapk11)
   04068 FoxO signaling pathway
    110310903 (Mapk11)
   04071 Sphingolipid signaling pathway
    110310903 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110310903 (Mapk11)
   04218 Cellular senescence
    110310903 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110310903 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110310903 (Mapk11)
   04613 Neutrophil extracellular trap formation
    110310903 (Mapk11)
   04620 Toll-like receptor signaling pathway
    110310903 (Mapk11)
   04621 NOD-like receptor signaling pathway
    110310903 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    110310903 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    110310903 (Mapk11)
   04660 T cell receptor signaling pathway
    110310903 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    110310903 (Mapk11)
   04659 Th17 cell differentiation
    110310903 (Mapk11)
   04657 IL-17 signaling pathway
    110310903 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    110310903 (Mapk11)
   04670 Leukocyte transendothelial migration
    110310903 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110310903 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    110310903 (Mapk11)
   04917 Prolactin signaling pathway
    110310903 (Mapk11)
   04926 Relaxin signaling pathway
    110310903 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    110310903 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110310903 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    110310903 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    110310903 (Mapk11)
   04722 Neurotrophin signaling pathway
    110310903 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110310903 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110310903 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    110310903 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110310903 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110310903 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110310903 (Mapk11)
   05020 Prion disease
    110310903 (Mapk11)
   05022 Pathways of neurodegeneration - multiple diseases
    110310903 (Mapk11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110310903 (Mapk11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110310903 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110310903 (Mapk11)
   05135 Yersinia infection
    110310903 (Mapk11)
   05133 Pertussis
    110310903 (Mapk11)
   05152 Tuberculosis
    110310903 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110310903 (Mapk11)
   05161 Hepatitis B
    110310903 (Mapk11)
   05171 Coronavirus disease - COVID-19
    110310903 (Mapk11)
   05163 Human cytomegalovirus infection
    110310903 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110310903 (Mapk11)
   05169 Epstein-Barr virus infection
    110310903 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110310903 (Mapk11)
   05140 Leishmaniasis
    110310903 (Mapk11)
   05142 Chagas disease
    110310903 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110310903 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110310903 (Mapk11)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110310903 (Mapk11)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110310903 (Mapk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 110310903
NCBI-ProteinID: XP_021039729
Ensembl: MGP_CAROLIEiJ_G0020155
UniProt: A0A6P5R7J7
LinkDB
Position
15
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAVDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTH
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccgcagcggctgcagggcctacgccccgtgggctccggcgcctacggctcagtctgctcg
gcctacgacgcgcggctgcgccagaaggtggctgtgaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctacgcctactcaaacacctgaagcac
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgacgaccctgatgggcgccgacctgaataacatcgtcaagtgtcag
gcactgagcgatgagcatgttcaattccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcggtgaacgag
gactgcgagctgaggatcctggactttgggctagcacgccaagctgatgaggagatgacc
ggatatgtggccacacggtggtaccgggcgccagagatcatgctaaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgaactgctgcaaggaaag
gccctctttcctggaaacgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acacccagtcctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag
tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggagccaaccctctg
gccgtggacctccttggaagaatgctggtactagacagtgaccagagggtcagtgcggcc
gaagccttggcccacgcatacttcagccagtaccatgaccctgacgatgagccagaggca
gagccctatgatgaaagtgttgaggccaaggagcgcacgctggaggagtggaaggagctt
acttaccaagaagtccttagcttcaagcccctggaaccgtcacagctccctggcacccat
gaaattgagcagtga

KEGG   Mus caroli (Ryukyu mouse): 110312437
Entry
110312437         CDS       T05910                                 

Gene name
Mapk14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04015  Rap1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05205  Proteoglycans in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110312437 (Mapk14)
   04015 Rap1 signaling pathway
    110312437 (Mapk14)
   04370 VEGF signaling pathway
    110312437 (Mapk14)
   04668 TNF signaling pathway
    110312437 (Mapk14)
   04068 FoxO signaling pathway
    110312437 (Mapk14)
   04071 Sphingolipid signaling pathway
    110312437 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110312437 (Mapk14)
   04218 Cellular senescence
    110312437 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110312437 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110312437 (Mapk14)
   04613 Neutrophil extracellular trap formation
    110312437 (Mapk14)
   04620 Toll-like receptor signaling pathway
    110312437 (Mapk14)
   04621 NOD-like receptor signaling pathway
    110312437 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    110312437 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    110312437 (Mapk14)
   04660 T cell receptor signaling pathway
    110312437 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    110312437 (Mapk14)
   04659 Th17 cell differentiation
    110312437 (Mapk14)
   04657 IL-17 signaling pathway
    110312437 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    110312437 (Mapk14)
   04670 Leukocyte transendothelial migration
    110312437 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110312437 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    110312437 (Mapk14)
   04917 Prolactin signaling pathway
    110312437 (Mapk14)
   04926 Relaxin signaling pathway
    110312437 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    110312437 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110312437 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    110312437 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    110312437 (Mapk14)
   04722 Neurotrophin signaling pathway
    110312437 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110312437 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110312437 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    110312437 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110312437 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110312437 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110312437 (Mapk14)
   05020 Prion disease
    110312437 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    110312437 (Mapk14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110312437 (Mapk14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110312437 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110312437 (Mapk14)
   05135 Yersinia infection
    110312437 (Mapk14)
   05133 Pertussis
    110312437 (Mapk14)
   05152 Tuberculosis
    110312437 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110312437 (Mapk14)
   05161 Hepatitis B
    110312437 (Mapk14)
   05171 Coronavirus disease - COVID-19
    110312437 (Mapk14)
   05163 Human cytomegalovirus infection
    110312437 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312437 (Mapk14)
   05169 Epstein-Barr virus infection
    110312437 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110312437 (Mapk14)
   05140 Leishmaniasis
    110312437 (Mapk14)
   05142 Chagas disease
    110312437 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110312437 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110312437 (Mapk14)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110312437 (Mapk14)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110312437 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 110312437
NCBI-ProteinID: XP_021041676
Ensembl: MGP_CAROLIEiJ_G0021328
UniProt: A0A6P5RF57
LinkDB
Position
17
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgaacgataccagaacctgtccccggtgggctcgggcgcctatggctcggtgtgtgct
gcttttgatacaaagacggggcatcgtgtggcagttaagaagctgtcgagaccgtttcag
tccatcattcacgccaaaaggacctaccgagagttgcgcctgctgaagcacatgaaacac
gagaatgtgattggtctgttggatgtgtttacacccgcaaggtcactggaggaattcaac
gacgtgtacctggtgacccatctcatgggggcagacttgaacaacatcgtgaagtgccag
aagctgaccgacgaccacgttcagtttctcatctaccagatcctccgagggctgaagtat
atacattcggctgacataattcacagggacctaaagcccagcaacctagctgtgaacgaa
gactgtgagctcaagattctggattttgggctggctcggcacactgatgatgagatgaca
ggctacgtggctaccaggtggtaccgagccccggagatcatgctgaattggatgcactac
aaccaaacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga
acgttgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttctgaagaaaatctcctcagagtctgcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtcgacctgctggagaagatgctcgttttggactcagataagaggatcacagcagcc
caagctcttgcgcacgcctactttgctcagtaccacgaccctgatgatgagcctgttgct
gacccttatgaccagtcctttgagagcagggacctcctcatagatgagtggaagagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagaaatggagtcc
tga

KEGG   Mus caroli (Ryukyu mouse): 110312562
Entry
110312562         CDS       T05910                                 

Gene name
Mapk13
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01522  Endocrine resistance
mcal04010  MAPK signaling pathway
mcal04015  Rap1 signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04114  Oocyte meiosis
mcal04218  Cellular senescence
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04370  VEGF signaling pathway
mcal04380  Osteoclast differentiation
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04611  Platelet activation
mcal04613  Neutrophil extracellular trap formation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04622  RIG-I-like receptor signaling pathway
mcal04625  C-type lectin receptor signaling pathway
mcal04657  IL-17 signaling pathway
mcal04658  Th1 and Th2 cell differentiation
mcal04659  Th17 cell differentiation
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04668  TNF signaling pathway
mcal04670  Leukocyte transendothelial migration
mcal04714  Thermogenesis
mcal04722  Neurotrophin signaling pathway
mcal04723  Retrograde endocannabinoid signaling
mcal04728  Dopaminergic synapse
mcal04750  Inflammatory mediator regulation of TRP channels
mcal04912  GnRH signaling pathway
mcal04914  Progesterone-mediated oocyte maturation
mcal04917  Prolactin signaling pathway
mcal04926  Relaxin signaling pathway
mcal04933  AGE-RAGE signaling pathway in diabetic complications
mcal04935  Growth hormone synthesis, secretion and action
mcal05014  Amyotrophic lateral sclerosis
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05132  Salmonella infection
mcal05133  Pertussis
mcal05135  Yersinia infection
mcal05140  Leishmaniasis
mcal05142  Chagas disease
mcal05145  Toxoplasmosis
mcal05152  Tuberculosis
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05169  Epstein-Barr virus infection
mcal05170  Human immunodeficiency virus 1 infection
mcal05171  Coronavirus disease - COVID-19
mcal05205  Proteoglycans in cancer
mcal05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcal05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110312562 (Mapk13)
   04015 Rap1 signaling pathway
    110312562 (Mapk13)
   04370 VEGF signaling pathway
    110312562 (Mapk13)
   04668 TNF signaling pathway
    110312562 (Mapk13)
   04068 FoxO signaling pathway
    110312562 (Mapk13)
   04071 Sphingolipid signaling pathway
    110312562 (Mapk13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110312562 (Mapk13)
   04218 Cellular senescence
    110312562 (Mapk13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110312562 (Mapk13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110312562 (Mapk13)
   04613 Neutrophil extracellular trap formation
    110312562 (Mapk13)
   04620 Toll-like receptor signaling pathway
    110312562 (Mapk13)
   04621 NOD-like receptor signaling pathway
    110312562 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    110312562 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    110312562 (Mapk13)
   04660 T cell receptor signaling pathway
    110312562 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    110312562 (Mapk13)
   04659 Th17 cell differentiation
    110312562 (Mapk13)
   04657 IL-17 signaling pathway
    110312562 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    110312562 (Mapk13)
   04670 Leukocyte transendothelial migration
    110312562 (Mapk13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110312562 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    110312562 (Mapk13)
   04917 Prolactin signaling pathway
    110312562 (Mapk13)
   04926 Relaxin signaling pathway
    110312562 (Mapk13)
   04935 Growth hormone synthesis, secretion and action
    110312562 (Mapk13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110312562 (Mapk13)
  09156 Nervous system
   04728 Dopaminergic synapse
    110312562 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    110312562 (Mapk13)
   04722 Neurotrophin signaling pathway
    110312562 (Mapk13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110312562 (Mapk13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110312562 (Mapk13)
  09159 Environmental adaptation
   04714 Thermogenesis
    110312562 (Mapk13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110312562 (Mapk13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110312562 (Mapk13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    110312562 (Mapk13)
   05020 Prion disease
    110312562 (Mapk13)
   05022 Pathways of neurodegeneration - multiple diseases
    110312562 (Mapk13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110312562 (Mapk13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110312562 (Mapk13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110312562 (Mapk13)
   05135 Yersinia infection
    110312562 (Mapk13)
   05133 Pertussis
    110312562 (Mapk13)
   05152 Tuberculosis
    110312562 (Mapk13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110312562 (Mapk13)
   05161 Hepatitis B
    110312562 (Mapk13)
   05171 Coronavirus disease - COVID-19
    110312562 (Mapk13)
   05163 Human cytomegalovirus infection
    110312562 (Mapk13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312562 (Mapk13)
   05169 Epstein-Barr virus infection
    110312562 (Mapk13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110312562 (Mapk13)
   05140 Leishmaniasis
    110312562 (Mapk13)
   05142 Chagas disease
    110312562 (Mapk13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110312562 (Mapk13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110312562 (Mapk13)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110312562 (Mapk13)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110312562 (Mapk13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2 SSXRD
Other DBs
NCBI-GeneID: 110312562
NCBI-ProteinID: XP_021041918
Ensembl: MGP_CAROLIEiJ_G0021329
UniProt: A0A6P5RFU2
LinkDB
Position
17
AA seq 366 aa
MSLTRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEDKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARPTDTEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAADLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLSVDEWKQHIYKEISNFSPIARTDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcactcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag
ctacccaagacctacctggcgccggcgcacgtcggcagcggggcctatggagcggtgtgc
tcggccatcgacaagcggacaggggagaaggtggccatcaagaagctgagccggcccttc
cagtccgagatctttgccaagcgcgcctaccgcgagcttctgctcctgaagcacatgcac
catgagaacgtcattgggcttcttgatgtcttcacccctgcgtcttcccttcggaacttc
catgatttctatctggtgatgcccttcatgcagacagacctacagaagatcatggggatg
gaattcagcgaggataaggtccagtacttggtgtaccagatgctcaaaggtctaaagtac
atccactccgctggcatcgtccacagggacctgaagccgggcaacctggccgtgaatgaa
gactgtgagctgaagatcctggactttgggctggcccgccccacggacactgagatgacg
ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcattac
aaccagacagtggacatctggtctgttggttgcatcatggcagaaatgctgaccggaaag
acactcttcaagggcaaggactacctggaccagctgacccagatcctgaaagtgactggg
gtgccaggtgctgagttcgtgcagaagctgaaagacaaggcggccaaatcctatattcag
tccctgccccagagccccaagaaggatttcacacagctcttcccacgcgccagcccgcaa
gctgcagacctgctggacaagatgctggagctggatgtggacaaacgtctgactgctgct
caggcactggctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc
cagcagccttttgatgatgccttagaacatgagaaactcagcgtggacgaatggaaacaa
cacatctacaaagagatctcaaacttcagtcccatagcccggacggactcacggcgacga
agtggcatgaagctgcagtga

DBGET integrated database retrieval system