KEGG   Mus caroli (Ryukyu mouse): 110310932
Entry
110310932         CDS       T05910                                 

Gene name
Thbs1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04015  Rap1 signaling pathway
mcal04115  p53 signaling pathway
mcal04145  Phagosome
mcal04151  PI3K-Akt signaling pathway
mcal04350  TGF-beta signaling pathway
mcal04510  Focal adhesion
mcal04512  ECM-receptor interaction
mcal05144  Malaria
mcal05165  Human papillomavirus infection
mcal05205  Proteoglycans in cancer
mcal05206  MicroRNAs in cancer
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110310932 (Thbs1)
   04350 TGF-beta signaling pathway
    110310932 (Thbs1)
   04151 PI3K-Akt signaling pathway
    110310932 (Thbs1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    110310932 (Thbs1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110310932 (Thbs1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    110310932 (Thbs1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110310932 (Thbs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110310932 (Thbs1)
   05205 Proteoglycans in cancer
    110310932 (Thbs1)
  09162 Cancer: specific types
   05219 Bladder cancer
    110310932 (Thbs1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110310932 (Thbs1)
  09174 Infectious disease: parasitic
   05144 Malaria
    110310932 (Thbs1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110310932 (Thbs1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mcal00536]
    110310932 (Thbs1)
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110310932 (Thbs1)
Membrane trafficking [BR:mcal04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110310932 (Thbs1)
Glycosaminoglycan binding proteins [BR:mcal00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   110310932 (Thbs1)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   110310932 (Thbs1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA Laminin_G_3 Laminin_G_2 TSP1_CCN EGF Laminin_G_1
Other DBs
NCBI-GeneID: 110310932
NCBI-ProteinID: XP_021039776
Ensembl: MGP_CAROLIEiJ_G0024112
UniProt: A0A6P5RAS8
LinkDB
Position
2
AA seq 1170 aa
MELLRGLGVLFLLHMCGSNRIPESGGDNGVFDIFELIGGARRGPGRRLVKGQDLSSPAFR
IENANLIPAVPDDKFQDLLDAVWADKGFIFLASLRQMKKTRGTLLAVERKDNSGQIFSVV
SNGKAGTLDLSLSLPGKQQVVSVEEALLATGQWKSITLFVQEDRAQLYIDCDKMESAELD
VPIQSIFTRDLASVARLRVAKGDVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGLSCDELSSMVLELKGLRTIVTTLQDSIRK
VTEENRELVSELRRPPLCFHNGVQYKNNEEWTVDSCTECHCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSPWDICSVTCGGGVQRRSRLCNNPTPQFGGKDCVGDVTENQV
CNKQDCPIDGCLSNPCFAGAKCTSYPDGSWKCGACPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCKNTDPGYNCLPCPPRFTGSQPFGRGVEHAMANKQVCKPRNPCTDGTHDCNKN
AKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAVDIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDLIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENFDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDMKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggagctcctgcggggattaggtgtcctgttcctgttgcatatgtgtggaagcaaccgc
attccagagtctgggggagacaacggtgtgtttgacatctttgagctcattggaggtgca
cgaaggggccccggtcgccgactggtgaagggccaagatctatccagccctgccttccga
attgagaatgccaacctgatccccgctgtgccggatgacaagttccaagacctactggat
gctgtgtgggcagacaaaggcttcatcttcctggcttccttgaggcagatgaagaagact
cggggcacactcctggctgtggaacggaaagacaacagtggccagatcttcagtgtggtc
tccaacggcaaagctggcaccctggacctgagcctgagcctgccggggaagcaacaagtg
gtgtcagtggaggaagctctcctggccactggccagtggaagagcatcacgctgtttgtt
caagaggaccgggctcaactctacattgactgtgataagatggagagcgcggagctggat
gtacccatccagagcatcttcaccagggatctggccagcgttgctaggctccgagttgca
aagggagatgtcaatgacaattttcagggggtgctgcagaatgtgaggtttgtctttgga
accaccccagaagacattctcaggaacaaaggctgctccagctctaccaacgtccttctc
acccttgacaacaacgtggtgaacggttccagccctgcgatccgcaccaactacatcggc
cacaaaacaaaggacctccaagctatctgtggcctctcctgtgacgaactatccagcatg
gtcctggaactgaagggcctgcgcaccatcgtgaccacgctgcaggacagcatccgcaaa
gtgacggaagaaaacagagagctggtcagtgagctgaggcggcctcccctctgctttcac
aatggagtccagtacaagaacaacgaggagtggactgtagacagttgcacagagtgtcac
tgccagaactcggttaccatctgcaaaaaggtgtcctgtcccatcatgccctgctccaac
gccacagttcctgatggtgaatgctgcccacggtgctggcccagcgactctgctgacgat
ggctggtctccctggtctgagtggacctcctgctctgccacatgtggcaatgggattcag
caacgtggtcgctcctgtgacagcctcaacaacagatgcgagggctcttcggtacagacg
aggacctgccacattcaggagtgcgacaaaagatttaaacaggatggtggctggagtcac
tggtctccgtggtcgtcctgttctgtgacctgtggtgacggtgtgatcacaaggatccgg
ctctgcaactcccccagcccccagatgaacgggaagccctgtgaaggtgaagcccgggag
accaaagcctgcaagaaagatgcctgcccaattaatggaggctggggtccctggtcacca
tgggacatctgctctgtcacctgtggaggaggagtgcagagacgcagccgactctgtaac
aaccccacaccccagtttggaggcaaagactgtgttggcgatgtgacagaaaatcaagtt
tgcaacaagcaggactgtccgattgatggatgcctgtccaatccctgctttgctggtgcc
aagtgtactagctaccctgatggtagctggaaatgtggtgcgtgtcctcctggctacagt
ggaaatggcatccagtgcaaagacgtcgatgagtgcaaagaagtgcctgatgcttgcttc
aatcacaacggagaacatcggtgcaagaacacagatcctggctacaactgcctgccctgc
ccaccacgattcaccggctcacagcccttcggccgaggtgtcgaacatgccatggccaac
aaacaggtgtgcaaacctcgaaacccctgcacggacgggacgcatgactgcaacaagaac
gccaagtgcaactacctgggtcactacagcgaccccatgtaccgctgtgagtgcaagccc
ggctacgcaggcaatggcatcatctgcggagaggacacagacctggacggctggcctaat
gaaaacctggtgtgtgtggccaacgcaacctaccactgcaaaaaggacaactgtcccaac
cttcccaactcagggcaggaagactatgacaaggacgggattggcgatgcctgcgatgat
gacgatgacaacgacaagatccccgatgacagggacaactgtccattccattacaaccca
gcccagtatgactatgacagagatgatgtgggagaccgctgtgacaactgcccctacaac
cacaaccctgaccaagcagacacagacaacaacggggagggcgatgcctgtgcggtggac
atcgatggagatggaatcctcaatgaacgagacaactgccagtacgtttacaacgtggac
cagagggacacggacatggatggggttggagatcagtgtgacaactgccccctggaacac
aatccagaccagctggactctgactcagacctcataggggacacttgtgacaacaatcag
gacatcgatgaggatggccatcagaacaatctggacaactgtccctatgtgcctaatgcc
aaccaggccgaccatgataaagatggcaaaggagatgcctgtgaccatgacgatgacaat
gacggcatccctgatgacagagacaactgcaggctggtgcccaatcctgaccagaaggac
tctgatggtgatggccgaggtgatgcctgcaaagacgactttgaccatgacaatgtgcca
gacattgatgacatctgtcctgagaattttgacatcagtgaaaccgatttccgacgattc
cagatgattcctctagatcccaaaggaacctcccaaaatgatcctaactgggttgtccgc
catcagggcaaagaactcgtccagactgtaaactgtgaccctggacttgctgtaggttat
gatgagtttaatgccgtggacttcagcggtaccttcttcatcaacaccgagagagatgat
gactatgctggctttgttttcggctaccagtccagcagccgcttctacgttgtgatgtgg
aaacaagtcacccagtcctactgggacaccaaccccacaagagctcagggatactcaggc
ctgtctgtaaaggttgtgaactccaccaccggccctggcgagcacctgcggaatgcactg
tggcacacaggaaacacccctggccaggtgcgcaccctgtggcatgaccctcgccacatc
ggctggaaagatttcactgcgtacagatggcggctcagccacaggccaaagaccggtttt
atcagagtggtgatgtatgaaggaaagaaaatcatggctgactcgggacccatctatgac
aaaacctacgccggcggtagactaggcctgttcgtcttctctcaagaaatggtgttcttc
tcggacatgaaatacgagtgtcgagattcctaa

DBGET integrated database retrieval system