KEGG   Mus caroli (Ryukyu mouse): 110310977
Entry
110310977         CDS       T05910                                 

Gene name
Upk3a
Definition
(RefSeq) uroplakin-3a isoform X1
  KO
K19520  uroplakin-3a
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05219 Bladder cancer
    110310977 (Upk3a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcal04147]
    110310977 (Upk3a)
Exosome [BR:mcal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110310977 (Upk3a)
SSDB
Motif
Pfam: PTP_tm Uroplakin_II
Other DBs
NCBI-GeneID: 110310977
NCBI-ProteinID: XP_021039831
Ensembl: MGP_CAROLIEiJ_G0020121
UniProt: A0A6P5RAX1
LinkDB
Position
15
AA seq 287 aa
MLLLWALLALGCLRCGWTVNLQPQLASVTFATNNPTLTTVALEKPLCMFDSSEPLSGSYE
VYLYAMVDSAMSRNMSVQDSAGVPLSTTFRQTQGGRSGPYKAAAFDLTPCGDLPSLDAVG
DVTQASEILNAYLVRVGNNGTCFWDPNFQGLCNPPLTAATEYRFKYVLVNMSTGLVQDQT
LWSDPIRTNRPIPYSAIDTWPGRRSGGMIVITSILGSLPFFLLVGFAGAIILSFVDMGSS
DGEMTHDSQITQEAVPKTLGTSEPSYSSVNRGPPLDRAEVFSSKLQD
NT seq 864 nt   +upstreamnt  +downstreamnt
atgctcctgctctgggccctgctggctctcggatgcctgcggtgtggctggactgtgaac
ctccagccccaactggccagtgtgacctttgccaccaacaaccctaccctcaccacggtg
gccttggagaagcctctgtgcatgttcgatagctcagagccactcagcggctcttacgag
gtttacctctatgctatggtcgattcagccatgtccaggaatatgtctgtacaggacagc
gctggcgttccactgagcaccactttccggcaaacccagggtgggaggtcaggcccctat
aaagctgcggcctttgacctgaccccttgtggtgacttgcctagcctggatgctgttgga
gacgtgacccaggcctcagagatcctgaacgcatacctagtcagggtgggcaacaacggg
acctgtttttgggatcccaacttccagggcctctgcaacccacccctgacagcagccact
gagtacagattcaaatatgtcctggtcaacatgtccacaggcttggtgcaggaccagaca
ctatggtcagatcccatccggaccaaccggcccatcccctactcggccatcgacacgtgg
cccggccggcggagtggaggcatgattgtcatcacgtccattctgggatccctgcccttc
ttcctgctcgtgggtttcgctggagccatcatcctcagctttgtggacatgggcagttct
gatggggaaatgacacatgactcacagatcacccaggaggccgtccccaagaccctgggg
acttcagagccttcgtactcatctgtgaaccggggcccacccctagacagagcagaggtg
ttctccagcaagcttcaagactga

DBGET integrated database retrieval system