KEGG   Mus caroli (Ryukyu mouse): 110311017
Entry
110311017         CDS       T05910                                 

Gene name
Mafa
Definition
(RefSeq) transcription factor MafA
  KO
K07595  transcription factor MAFA
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04930  Type II diabetes mellitus
mcal04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110311017 (Mafa)
   04950 Maturity onset diabetes of the young
    110311017 (Mafa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110311017 (Mafa)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Maf
    110311017 (Mafa)
SSDB
Motif
Pfam: bZIP_Maf Maf_N bZIP_1 KASH_CCD FapA
Other DBs
NCBI-GeneID: 110311017
NCBI-ProteinID: XP_021039855
Ensembl: MGP_CAROLIEiJ_G0019896
UniProt: A0A6P5R5K2
LinkDB
Position
15
AA seq 359 aa
MAAELAMGAELPSSPLAIEYVNDFDLMKFEVKKEPPEAERFCHRLPPGSLSSTPLSTPCS
SVPSSPSFCAPSPGTGGGAGGGGSAAQAGGAPGPPSGGPGTVGGASGKAVLEDLYWMSGY
QHHLNPEALNLTPEDAVEALIGSGHHGAHHGAHHPAAAAAYEAFRGQSFAGGGGADDMGA
GHHHGAHHTAHHHHSAHHHHHHHHHHGGSGHHGGGAGHGGGGAGHHVRLEERFSDDQLVS
MSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVE
QLKLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAKGAPDFFL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggccgcggagctggcgatgggcgcagagctgcccagcagcccactggccatcgagtac
gtcaacgacttcgacctgatgaagttcgaggtgaagaaggagccgcccgaggccgagcgc
ttctgccaccgcctgccgcccggctcgctgtcctcgacgcccctcagcacgccctgctcc
tcggtgccctcttcgcccagcttctgcgcacccagcccgggcaccggcggcggcgcgggc
ggcgggggcagcgcggctcaggccgggggcgccccggggccgccgagtggaggccccggc
actgtcgggggcgcctcaggaaaagcggtgctggaggatctgtactggatgagcgggtac
cagcaccacctgaaccccgaggcgctcaatctgacgccggaggacgcggtggaggcgctc
atcggcagcggccaccacggcgcgcaccacggcgcgcatcacccggcggctgctgcggcc
tatgaggccttccggggccagagcttcgcgggcggcggcggcgcggacgacatgggtgcc
ggccaccaccacggcgcacaccacactgcccaccatcatcactctgcccaccatcaccat
catcaccaccaccaccacggaggctctggccaccacggcggaggcgcgggtcacggcgga
ggcggcgcgggccaccacgtgcgcttggaggagcgcttttccgacgaccagctggtgtcc
atgtctgtgcgggagctgaaccggcagctccgcggtttcagcaaggaggaggtcatccga
ctgaaacagaagcggcgcacgctcaagaaccgcggctacgcgcagtcgtgccgcttcaag
cgggtgcagcagcggcacattctggagagcgagaagtgccagctccagagccaggtggag
cagctgaagctggaggtggggcgtctggccaaggagcgggacctgtacaaggagaaatac
gagaagttggcgggccggggcggccccgggggcgcgggcggggccggcttccctcgggag
ccctcgccagcgcaggctggccccggggcggccaaaggcgcacccgacttctttctgtga

DBGET integrated database retrieval system