KEGG   Mus caroli (Ryukyu mouse): 110311246
Entry
110311246         CDS       T05910                                 

Gene name
Erg
Definition
(RefSeq) transcriptional regulator ERG isoform X1
  KO
K09435  transcriptional regulator ERG
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110311246 (Erg)
  09162 Cancer: specific types
   05215 Prostate cancer
    110311246 (Erg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110311246 (Erg)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    110311246 (Erg)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 Arb2
Other DBs
NCBI-GeneID: 110311246
NCBI-ProteinID: XP_021040159
Ensembl: MGP_CAROLIEiJ_G0020995
UniProt: A0A6P5R5L1
LinkDB
Position
16
AA seq 479 aa
MASTIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQQDWLSQT
PARVTIKMECNPSQVNGSRNSPDECSVNKGGKMVGSPDTVGMSYGSYMEEKHVPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLLDVDVLLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEA
TQRITTRPDLPYEPPRRSAWTGHSHLTPQSKAAQPSPSAVPKTEDQRPQLDPYQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVSPHPPALPVTSSSFFASPNPYWNSPTGGIYPNTRLPASHMPSHLGTYY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggccagcactattaaggaggccttgtcagttgtgagcgaggaccagtcactatttgag
tgtgcctacggaacgccacacctggctaagacagagatgaccgcatcctcttccagtgac
tatggccagacatccaagatgagtcccagagtccctcagcaggactggctgtctcaaacc
ccagccagggtcaccatcaagatggagtgcaaccctagtcaggtgaacggttccaggaac
tcacctgatgagtgcagtgtgaacaaaggtgggaagatggtgggcagcccggatactgtg
gggatgagctacggcagctacatggaggagaagcatgtgccgccccccaatatgaccaca
aatgagcgcagagtgatcgtccctgcagatcctactctgtggagcacagaccatgtccga
cagtggctggagtgggcagtgaaagaatacggcctcctggatgtggacgtcttactattt
cagaatatcgacgggaaggagctgtgcaagatgacaaaggatgacttccagcggctcacg
ccgagctacaacgccgatattcttctctcacatctccactacctcagagagactcccctt
ccacatctgacttccgacgacgttgataaggctttacaaaactctccacggttaatgcat
gccagaaacacagggggtgcagcttttattttcccaaatacttccgtatatcccgaagct
acgcaaagaattacaactaggccagatttaccttatgagcctcccaggagatcagcctgg
accggccacagccacctcacccctcagtccaaagctgctcagccgtctccctctgcagtg
cccaaaactgaagaccagcgtcctcagttagatccttaccagatcctgggacccaccagt
agccgccttgctaatccaggtagtggccagatccagctgtggcagttcctgctcgaactc
ctgtcagacagctccaactccaactgcatcacctgggaaggcaccaacggggagttcaag
atgacagacccggacgaggtggctcgacgctggggggagaggaagagcaagcccaacatg
aactatgacaagctcagccgtgccctccgctactactacgacaaaaacatcatgaccaag
gtgcacgggaagcgctatgcctacaagtttgacttccacgggattgcccaggccctgcag
ccccaccctcctgagtcgtccctgtacaagtatccctccgacctgccatacatgggctcc
tatcacgcccacccccagaagatgaactttgtgtctccccaccctccagccctcccagtc
acatcttccagtttctttgcttccccgaacccatactggaattcaccaactgggggcatc
tacccgaacactaggctcccagccagccatatgccctctcacctgggcacctactactag

DBGET integrated database retrieval system