KEGG   Mus caroli (Ryukyu mouse): 110311359
Entry
110311359         CDS       T05910                                 

Definition
(RefSeq) interferon-induced GTP-binding protein Mx2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05160  Hepatitis C
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110311359
   05171 Coronavirus disease - COVID-19
    110311359
   05164 Influenza A
    110311359
   05162 Measles
    110311359
   05165 Human papillomavirus infection
    110311359
SSDB
Motif
Pfam: Dynamin_M Dynamin_N MMR_HSR1 AAA_21 AAA_29 CHDNT ABC_tran AAA_16 AAA_15
Other DBs
NCBI-GeneID: 110311359
NCBI-ProteinID: XP_021040258
Ensembl: MGP_CAROLIEiJ_G0008949
LinkDB
Position
16
AA seq 588 aa
MVLSTEDXRSIDSVNLPSGETGLGEKDQESVNNLCSQYEEKVRPCIDLIDSLRALGVEQD
LALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYD
DIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAV
GNQPADIGXQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPXGDRTIGILT
KPDLVDRGTEDKVVDVVRNLVYHLKKGYMIVKCRGQQDIQEQLSLTEALQNEQIFFKEHP
HFRVLLEDGKATVPCLAERLTAELISHICKSLPLLENQIKESHQSASEELQKYGMDIPED
DSEKTFFLIEKXNAFNQDITALVQGEENVAEGECRLFTRLRKEFLSWSMEIEKNFKKGYA
VLYNEVWTFEKQYRGRELPGFVNYKTFENIIRRQIKTLEEPAIEMLHKVTEIVRAAFTSV
SEKNFSEFFNLHRTTKSKLEDIRLEQEKEAETSIRLHFKMEQIIYCQDQIYRGALQKVRE
EEAEEEKKKTKHGTFSSSQSQDLQTSSMAEIFQHLNAYRQGQGAMRET
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggttcttagcacagaagacaanagaagcattgattcagtcaacttacccagtggagag
actggcctaggagagaaagaccaggagtctgtgaacaatctctgcagtcagtacgaggag
aaagtgcggccctgcattgacctcatcgactccctgcgggctctgggtgtggagcaggac
ttggccctgcctgccatcgctgtcattggggaccagagttcagggaagagctctgtgctc
gaagcattgtctggagtggccctccctagaggcagtggtattgtcaccagatgccctctg
gtgctgaaattgaggaagctgaatgagggagaggagtggagaggcaaagtctcctatgat
gacatcgaagtggagctctctgatccttcagaggtggaagaggccatcaacaagggtcag
aatttcattgctggggtaggcctggggatcagtgataagctcattagcctggatgtcagc
tccccaaatgtcccagacctgactctcattgacctgcctggaattaccagggtggctgta
ggcaaccagcctgcagacataggacnccagatcaagagactcatcaagacatacatccaa
aaacaggagaccatcaacctggtggtggtccccagcaatgtggacattgccaccacagag
gctctgagcatggctcaggaggtggaccctganggggataggaccatagggatcttgacc
aagcccgatctggtggacagaggtactgaagacaaggtcgtggatgtggtgcggaacctg
gtgtaccatctgaagaagggctacatgatagtcaagtgcagaggtcagcaggacatccaa
gagcagctgagcctgactgaggcgcttcagaatgagcaaatcttcttcaaggaacaccct
catttcagagttcttctggaggatgggaaggccacagtgccctgcctggcagagagactg
accgcagagctcatctcacacatctgtaaatctcttcctctgttagaaaatcaaataaag
gaaagtcaccagagtgcaagtgaggagctgcagaagtacggtatggacataccagaagat
gacagtgaaaaaactttcttcctgattgaaaaantcaatgcttttaaccaggacatcact
gccctagtacaaggggaagagaatgtggcagagggagaatgtcgcctattcaccaggctc
cgaaaagagttcttgtcctggagtatggagatcgaaaagaatttcaaaaaaggttatgct
gttttatataatgaagtctggacgtttgaaaagcagtatcgtggccgagaactgccaggg
tttgtgaattacaaaacatttgagaacattataagaagacaaatcaaaaccctggaagaa
ccagctatagaaatgctgcacaaggtcactgaaattgtacgagctgcctttacaagtgtt
tctgagaaaaatttttctgagttttttaacctccacagaactaccaagtccaaacttgaa
gacatcagattagaacaagaaaaggaagcagagacgtcaatccgactccacttcaagatg
gaacaaattatctactgccaggatcagatttacagaggagccttgcagaaggtcagagag
gaggaagctgaggaggagaagaagaagacaaagcatggcactttcagttcctctcagtcc
caagatttacagacctcatccatggctgagatcttccagcatctgaatgcctaccgccag
ggccaaggggctatgagggagacctaa

KEGG   Mus caroli (Ryukyu mouse): 110311566
Entry
110311566         CDS       T05910                                 

Definition
(RefSeq) interferon-induced GTP-binding protein Mx1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05160  Hepatitis C
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110311566
   05171 Coronavirus disease - COVID-19
    110311566
   05164 Influenza A
    110311566
   05162 Measles
    110311566
   05165 Human papillomavirus infection
    110311566
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 Ssu72 AAA_21 AAA_16 AAA_29 AdoHcyase ABC_tran PaO
Other DBs
NCBI-GeneID: 110311566
NCBI-ProteinID: XP_021040612
UniProt: A0A6P7Q7R5
LinkDB
Position
16
AA seq 631 aa
MESVNNLCSQYEEKVQPCIDLINSLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVA
LPRGSGIVTRCPLVLKLKQLKQGEKWRGKIIYKDTEINISSPSKVEREINKAQNLIAGER
FQISSELISLEISSPHVPDLTLIDLPGITRLAVGDQPKDIKHKIKKLIRTYIQKQETINL
VVVPSNVDIATTEALSMAREVDPDGDRTIGILTKPDLVDRGAEGKVVDVVRNLVYHLKKG
YMIVKCRGQQDIQEQLSLTEALQNEQVFFQEHPYFRILLKDGKATVPCLAKRLTEELTSH
ICKSLPLLEGQIKSSFQSTIKELQKYGADIPEDDSMRMSFLVNKISAFNRNIMNLIQAQE
PVSKGDSRLFTKLRNEFLAWDDHIEEHFKKDSPEVQSKMKEFENQYRGRELPGFVDYKAF
ESIIKKQVKALEESAVNMLRRVTKMVQTAFVKVLSNDFGDFLNLYRTAKSKIEDIRLNQE
KEAEKLIRIHFQMEQIVYCQDQVYKETLKTIEKEAEEEKTGVIVINLDTSQNNSQFPQKE
FTTKEMTQHLKAYYQECRRNIGRQIPLIIQYFILKTFGEEVEKTMLQLLQDTSKCSWFLE
EQSDTREKKKFLKRRLLRLHEARQKLAKFSD
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggagtctgtgaacaatctctgcagtcagtatgaggagaaggttcagccctgcattgac
ctcatcaactccctgcgggctctgggtgtggagcaggacctggccctgcctgccatcgct
gtcattggggaccagagttcagggaagagctctgtgctggaagcactgtctggagtggcc
ctccccagaggcagtggtatagttaccaggtgccctctggtgctgaaactgaaacaactc
aagcagggagaaaaatggagaggcaagatcatctataaggacaccgagattaatatatca
agcccctcaaaggtagaaagggaaattaataaagctcagaatttgattgctggggaaagg
ttccagattagctctgagctcattagcttggagatcagctctccacatgtcccagacttg
accctgattgacctgcctggtatcacaaggctggctgtaggtgaccagcctaaagacatc
aaacacaagatcaagaaactcatcaggacatacatccaaaaacaggagaccatcaacctg
gtggtggtccccagcaatgtggacattgccaccacagaggctctgagcatggctcgggag
gttgaccctgatggggataggaccatagggatattgaccaagcccgatctggtggacaga
ggtgctgaaggcaaggttgttgatgtggtgcggaacctggtataccatctgaagaagggc
tacatgatagtcaagtgcaggggtcagcaggacatccaggagcagctgagcctgactgag
gctcttcagaatgagcaagtcttcttccaggagcatccatacttcagaattcttctgaaa
gatgggaaggccacagtgccctgcctggcaaagagactgaccgaggagctcacctcccac
atctgtaaatcactgccactattggaaggtcaaataaagagcagttttcagagtacaatc
aaggagctgcagaagtacggtgcagacataccagaagatgacagtatgaggatgtccttt
ctggtgaataaaatcagtgccttcaataggaatatcatgaatttgatacaagcacaggaa
cccgtatcaaagggagacagccggttgtttaccaaattgcgaaatgagtttcttgcttgg
gatgatcatattgaggaacattttaaaaaagattctcctgaggtacaaagcaagatgaaa
gaatttgaaaatcagtatcgtggccgggagctgccagggtttgtggactacaaggcattt
gagagcatcatcaaaaagcaagtcaaagccctggaagagtctgctgtgaacatgctgcgc
agggtcactaagatggtccaaactgccttcgtaaaggttttatcaaatgattttggtgat
tttttaaacctctaccgtactgctaagtccaaaattgaagacataagattaaaccaagaa
aaagaagctgaaaaactgatccgaattcacttccagatggaacagattgtctactgccag
gaccaggtttacaaggaaaccttgaagacgatcgagaaggaagctgaggaagagaagact
ggggtgatagttataaacttggatacctctcaaaataactctcagtttcctcaaaaggag
ttcactaccaaggagatgacccagcacctgaaagcctactaccaggagtgcagaaggaat
attgggagacagatccctctgattatccagtacttcatcctgaaaacatttggggaggaa
gtagagaaaacgatgcttcagcttttacaggacaccagtaagtgcagctggttcctggag
gagcagagtgacaccagagagaagaagaagttcctgaagaggcggcttttaaggctgcat
gaggctcggcagaagcttgccaaattctccgattaa

DBGET integrated database retrieval system