KEGG   Mus caroli (Ryukyu mouse): 110311360
Entry
110311360         CDS       T05910                                 

Gene name
Tmprss2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal05164  Influenza A
mcal05171  Coronavirus disease - COVID-19
mcal05202  Transcriptional misregulation in cancer
mcal05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110311360 (Tmprss2)
  09162 Cancer: specific types
   05215 Prostate cancer
    110311360 (Tmprss2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110311360 (Tmprss2)
   05164 Influenza A
    110311360 (Tmprss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mcal01002]
    110311360 (Tmprss2)
Enzymes [BR:mcal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     110311360 (Tmprss2)
Peptidases and inhibitors [BR:mcal01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110311360 (Tmprss2)
SSDB
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2
Other DBs
NCBI-GeneID: 110311360
NCBI-ProteinID: XP_021040259
LinkDB
Position
16
AA seq 412 aa
MALNSGSPPGIGPCYENHGYQSEHICPPRPPVAPNGYNLYPAQCYPSPVPQYAPRITTQA
STSVIHTHPKSSGALCTSKSKKSLCLALALGTVLAGAAVAAVLLWRFWDSNCSTSEMECG
SSGTCISSSLWCDGIAHCPNGEDENRCECGVRSVKRQSRIVGGLNASPGDWPWQVSLHVQ
GVHVCGGSIITPEWIVTAAHCVEEPLSSPRYWTAFAGILRQSLMFYGSRHQVEKVISHPN
YDSKTKNNDIALMKLQTPLAFNDLVKPVCLPNPGMMLDLDQECWISGWGATYEKGEALGH
TGWDTDFHSGTPSFESQFSYSVVSVTQGSSLAEGKRIYCPQFEGAGHYCGEGMVSGAHDG
SGGPLVTLKNGIWWLIGDTSWGSGCAKALRPGVYGNVTVFTDWIYQQMRANS
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggcattgaactcagggtcacctccaggaatcggaccttgctatgagaaccacgggtat
cagtctgagcacatctgtcctccgaggccaccagtggctcccaatggctacaacttgtat
ccagcccagtgctacccatctccagtgccccagtatgctccgaggattacaacacaagcc
tcaacatctgtcatccacacacatcccaagtcctcaggagcactgtgcacctcaaagtct
aagaaatcgctgtgtttagccctcgccctgggcactgtcctcgcgggtgctgctgtggct
gctgtcttgctttggaggttctgggacagcaactgctctacgtctgagatggagtgtggg
tcttcaggcacatgcatcagctcttctctctggtgtgacgggatagcacattgtcccaat
ggagaagatgagaaccggtgtgaatgcggggttcgctcagtgaaacgccagagcaggatt
gtgggtggattgaatgcctcaccaggagactggccctggcaggtcagcctgcacgtccaa
ggcgtccacgtctgcggaggctccatcatcacccccgagtggattgtgacagccgcccac
tgtgtggaagaacccctcagcagcccgaggtactggacggcatttgcgggaattctgaga
cagtctctcatgttctatggaagtagacaccaggtagaaaaagtaatttcccatccaaat
tacgactctaagaccaagaataacgacattgctctcatgaagctgcagacacctttggct
tttaatgatctagtgaagccagtgtgtctgccaaacccaggcatgatgctagacctagac
caggaatgctggatttcggggtggggggccacctatgagaaaggtgaggctttgggtcac
acaggatgggacactgatttccacagtgggaccccttcatttgaatcccagttcagttat
tcagtggtttctgtaactcaagggagttccttagctgaagggaagaggatttattgtcca
cagtttgaaggtgccggccattattgtggggaaggcatggtatcaggagcacatgatggc
agtggagggccgctggttactttgaagaatgggatctggtggctgattggagacacgagc
tggggctcgggctgtgccaaggcactcagacctggagtatatgggaacgtgacggtattt
acagattggatctaccagcaaatgagggcgaacagctaa

DBGET integrated database retrieval system