KEGG   Mus caroli (Ryukyu mouse): 110311365
Entry
110311365         CDS       T05910                                 

Gene name
Gsk3b
Definition
(RefSeq) glycogen synthase kinase-3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01521  EGFR tyrosine kinase inhibitor resistance
mcal04012  ErbB signaling pathway
mcal04062  Chemokine signaling pathway
mcal04110  Cell cycle
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04310  Wnt signaling pathway
mcal04340  Hedgehog signaling pathway
mcal04360  Axon guidance
mcal04390  Hippo signaling pathway
mcal04510  Focal adhesion
mcal04550  Signaling pathways regulating pluripotency of stem cells
mcal04657  IL-17 signaling pathway
mcal04660  T cell receptor signaling pathway
mcal04662  B cell receptor signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04728  Dopaminergic synapse
mcal04910  Insulin signaling pathway
mcal04916  Melanogenesis
mcal04917  Prolactin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04931  Insulin resistance
mcal04932  Non-alcoholic fatty liver disease
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05010  Alzheimer disease
mcal05020  Prion disease
mcal05022  Pathways of neurodegeneration - multiple diseases
mcal05135  Yersinia infection
mcal05160  Hepatitis C
mcal05162  Measles
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05200  Pathways in cancer
mcal05210  Colorectal cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05217  Basal cell carcinoma
mcal05224  Breast cancer
mcal05225  Hepatocellular carcinoma
mcal05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    110311365 (Gsk3b)
   04310 Wnt signaling pathway
    110311365 (Gsk3b)
   04340 Hedgehog signaling pathway
    110311365 (Gsk3b)
   04390 Hippo signaling pathway
    110311365 (Gsk3b)
   04151 PI3K-Akt signaling pathway
    110311365 (Gsk3b)
   04150 mTOR signaling pathway
    110311365 (Gsk3b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110311365 (Gsk3b)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110311365 (Gsk3b)
   04550 Signaling pathways regulating pluripotency of stem cells
    110311365 (Gsk3b)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110311365 (Gsk3b)
   04657 IL-17 signaling pathway
    110311365 (Gsk3b)
   04662 B cell receptor signaling pathway
    110311365 (Gsk3b)
   04062 Chemokine signaling pathway
    110311365 (Gsk3b)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110311365 (Gsk3b)
   04917 Prolactin signaling pathway
    110311365 (Gsk3b)
   04935 Growth hormone synthesis, secretion and action
    110311365 (Gsk3b)
   04919 Thyroid hormone signaling pathway
    110311365 (Gsk3b)
   04916 Melanogenesis
    110311365 (Gsk3b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110311365 (Gsk3b)
   04722 Neurotrophin signaling pathway
    110311365 (Gsk3b)
  09158 Development and regeneration
   04360 Axon guidance
    110311365 (Gsk3b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311365 (Gsk3b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110311365 (Gsk3b)
   05225 Hepatocellular carcinoma
    110311365 (Gsk3b)
   05226 Gastric cancer
    110311365 (Gsk3b)
   05217 Basal cell carcinoma
    110311365 (Gsk3b)
   05215 Prostate cancer
    110311365 (Gsk3b)
   05213 Endometrial cancer
    110311365 (Gsk3b)
   05224 Breast cancer
    110311365 (Gsk3b)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110311365 (Gsk3b)
   05020 Prion disease
    110311365 (Gsk3b)
   05022 Pathways of neurodegeneration - multiple diseases
    110311365 (Gsk3b)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    110311365 (Gsk3b)
   04931 Insulin resistance
    110311365 (Gsk3b)
   04934 Cushing syndrome
    110311365 (Gsk3b)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110311365 (Gsk3b)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110311365 (Gsk3b)
   05162 Measles
    110311365 (Gsk3b)
   05163 Human cytomegalovirus infection
    110311365 (Gsk3b)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110311365 (Gsk3b)
   05165 Human papillomavirus infection
    110311365 (Gsk3b)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110311365 (Gsk3b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110311365 (Gsk3b)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mcal03036]
    110311365 (Gsk3b)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     110311365 (Gsk3b)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   110311365 (Gsk3b)
Chromosome and associated proteins [BR:mcal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    110311365 (Gsk3b)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 110311365
NCBI-ProteinID: XP_021040268
Ensembl: MGP_CAROLIEiJ_G0020736
UniProt: A0A6P5R8V7
LinkDB
Position
16
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASPPANATAASDTNAGDRGQTNNAASASASNST
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcggggcgaccgagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttgggagcatgaaagttagcagagataaagatggcagcaaggtaaccacagtg
gtggcaactcctgggcaggggcctgacaggccacaggaagtcagttatacagacacgaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattctggagaa
ctggttgccatcaagaaagttctacaggacaagcgatttaagaaccgagagctccagatc
atgagaaagctagaccactgtaacatagtgcgactgcggtatttcttctactcgagtggc
gagaagaaagatgaggtctaccttaacctggtgctggactatgttccggagacagtgtac
agagtcgccagacactatagtcgagccaagcagacactccctgtgatctatgtcaagttg
tatatgtaccagctgttcagaagtctagcctatatccattcctttggaatctgccatcga
gacattaaaccacagaacctcttgttggatcctgatacagctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagagcccaacgtttcctatatttgttctcgg
tactacagggcgccagagttgatctttggagccactgactacacgtccagtatagatgtg
tggtctgcaggctgtgtgttggctgaattattgctaggacaaccaatatttcctggggac
agtggtgtggatcagttggtggaaataataaaggtcctaggaacaccaacaagggagcaa
attagagaaatgaacccaaattatacagaattcaaattcccccaaatcaaggcacatcct
tggacaaaggtcttccgaccccgaactccaccagaggcaattgcactgtgcagccgtctg
ctggagtacacaccaaccgcccggctaacaccactggaagcttgtgcacattcatttttc
gatgaattgcgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aactttaccactcaagaactgtcaagtaacccccctctggccaccatccttatccctcct
catgctcggattcaagcagctgcttcaccgcctgccaacgccacagcagcctcagatact
aatgctggagaccgtggacagaccaataacgccgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system