KEGG   Mus caroli (Ryukyu mouse): 110311485Help
Entry
110311485         CDS       T05910                                 

Gene name
Slc7a4
Definition
(RefSeq) cationic amino acid transporter 4
  KO
K13866  solute carrier family 7 (cationic amino acid transporter), member 4
Organism
mcal  Mus caroli (Ryukyu mouse)
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mcal02000]
    110311485 (Slc7a4)
Transporters [BR:mcal02000]
 Solute Carrier Family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   110311485 (Slc7a4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-GeneID: 110311485
NCBI-ProteinID: XP_021040472
Ensembl: MGP_CAROLIEiJ_G0020521
LinkDB All DBs
Position
16
AA seq 635 aa AA seqDB search
MARGLPSTAHLARFCQKLNRLKPLEESSMETSLRRCLSTLDLTLLGVGGMVGSGLYVLTG
TVAKDMAGPAVLLSFLVAAVASLLAALCYAEFGARVPRTGSAYLFTYVSMGEIWAFLIGW
NVLLEYLIGGAAVARAWSGYLDAIFNHSIRNFTESHLGVWQVPFLAHYPDFLAAGILLVA
SAFVSCGARVSSWLNHTFSAISLIVILFIIVLGFILARPHNWSAEEGGFAPFGFSGILAG
TATCFYAFVGFDVIAASSEEAKNPRWAVPMAIAISLSLAAGAYILVSTVLTLMVPWHSLD
PDSALADAFYRRGYSWAGFIVAVGSICAMNTVLLSNLFSLPRIVYAMAADGLFFQVFARV
HPRTQVPVVGILVFGVLMALLALLLDLEALVQFLSIGTLLAYTFVATSIIVLRFQKASPP
SSPCLASPGPTAKKYDSFSDHIQLVGAEQTSMSEPGQLRPALKPFLGFLDGCSPGTAVAW
ALGILVASAISLACVLVFGNSDLHLPQWGYVLLLVISGAVFLSSLLVLGAHQQQKKQDTF
QIPLVPLTPALSILLNTCLMLKLSYLTWLRFIFWLLVGLVVYFGYGIWHSKENQREPLEL
TTAHYVVFPSGSLEETVQAVQPSSQSPVQESGCAE
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atggcccggggactgcccagtactgcccatttggcacgcttctgccagaaactgaaccgt
ctgaagccactggaagagtctagcatggagacatcactgcggcgctgcctgtccacactg
gacttgaccctactgggtgtgggtggcatggtgggatctgggctctatgtgctcacaggc
acagtggccaaggacatggctggccctgctgtgctcttgtcctttttggtggccgctgtg
gcctccctgctggcggccctatgctatgcagagtttggagcccgtgtgccccgtactggc
tcagcatacctattcacgtacgtgtccatgggggagatatgggcattcctcataggctgg
aatgtgcttctagaatacctcattggaggtgccgctgtagcccgtgcctggagtggctat
ttggatgccatctttaaccacagcattcgcaacttcacggagtctcacctgggcgtctgg
caggtgcccttcctagctcactatccagattttctggccgctggcattttactcgtggct
tctgcctttgtctcctgcggagcccgagtctcctcctggcttaaccacacgttctcagcc
atcagtctgattgtgatcctcttcatcattgtcctgggtttcatcctggcccgccctcac
aactggagcgcagaagaaggtggtttcgcacccttcggcttctctggcatcctggctggc
acagccacctgtttctatgcctttgtgggatttgatgttattgctgcctccagtgaggag
gccaaaaacccacggtgggcggtgcccatggccattgccatctccctcagcctggcagct
ggtgcctatattctggtctccactgtgttaaccctcatggtaccttggcacagcctagac
cctgactcggcgcttgcggatgctttctacaggcggggttacagctgggctggcttcatt
gtggcagttggctctatctgtgccatgaacaccgtcctgctcagcaacctcttctccctg
ccacgcattgtctacgccatggctgccgatgggctcttcttccaggtgtttgcccgtgta
cacccccggacacaggtgcctgtggtaggaatcctggtgtttggggtcctcatggccctc
ctggcactgctgctggaccttgaggcactggtccagttcctatccatcggcaccctgctg
gcctatacctttgtagccaccagcatcattgtgctgcgtttccaaaaagcttctccaccc
agctccccttgcctagccagccctggccccacagctaagaaatatgactccttttcagac
catatacagctagtgggtgctgagcagacctcaatgtctgagcctgggcagctgaggcca
gccctgaagcccttcctgggcttcctggatggatgcagccctggaaccgctgtagcctgg
gcgcttggcatcttggtagcctcggctatctctctggcgtgtgtgctggtcttcgggaac
tcagacctacacctcccacagtggggctatgtcttgctgctggtcatcagtggtgctgtc
tttctgtccagcctcctggtcctgggggctcatcagcagcaaaagaagcaagacactttc
cagatccctttggtgcccctgactccagccctgagcatccttctcaacacttgcctcatg
ctgaagctgagctacctgacctggctacgctttatcttctggctgctggtcggacttgtc
gtgtattttggctatggcatctggcacagcaaggagaaccagagggagccattggagctg
actacagcacactacgtggtattccccagtggcagcctggaggaaactgtgcaagctgtg
cagccctctagtcaatcaccagtccaggagtcaggttgtgctgagtag

DBGET integrated database retrieval system