KEGG   Mus caroli (Ryukyu mouse): 110311881
Entry
110311881         CDS       T05910                                 

Gene name
Adipoq
Definition
(RefSeq) adiponectin
  KO
K07296  adiponectin
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal03320  PPAR signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04920  Adipocytokine signaling pathway
mcal04930  Type II diabetes mellitus
mcal04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    110311881 (Adipoq)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    110311881 (Adipoq)
   03320 PPAR signaling pathway
    110311881 (Adipoq)
  09149 Aging
   04211 Longevity regulating pathway
    110311881 (Adipoq)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110311881 (Adipoq)
   04932 Non-alcoholic fatty liver disease
    110311881 (Adipoq)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcal04990]
    110311881 (Adipoq)
Domain-containing proteins not elsewhere classified [BR:mcal04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   110311881 (Adipoq)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 110311881
NCBI-ProteinID: XP_021041118
UniProt: A0A6P5R1M0
LinkDB
Position
16
AA seq 254 aa
MTPKGLRMLLLQALLFLLILPSHAEDDITTTEELAPALVPPPKGTCAGWMAGIPGHPGHN
GTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYV
YRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKD
VKVSLFKKDKAILFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVN
DSTFTGFLLYHDTN
NT seq 765 nt   +upstreamnt  +downstreamnt
atgacaccaaaagggctcaggatgctactgttgcaagctctcctgttcctcttaatcttg
cccagtcatgccgaggatgacattactacaactgaagagctagctcctgctttggtccct
ccacccaagggaacttgtgcaggttggatggcaggcatcccaggacatccaggccacaat
ggcacaccaggccgtgatggcagagatggcactcctggagagaagggagagaaaggagat
gcaggtcttcttggtcctaagggtgagacaggagatgttggaatgacaggagctgaaggg
ccacggggctttcccggaacccctggcaggaaaggagagcctggagaagccgcttatgtg
tatcgctcggcgttcagcgtggggctggagacccgcgtcactgttcccaatgttcccatt
cgctttactaagatcttctacaaccaacagaatcattatgacggcagcactggcaagttc
tactgcaacattccgggactctactacttctcctaccacatcacggtatacatgaaagat
gtgaaggtgagcctcttcaagaaggacaaggccattctcttcacctacgaccagtatcag
gaaaagaatgtggaccaggcctctggctctgtgctcctccatctggaggtgggagaccaa
gtctggctccaggtgtatggggatggggaccataatggactctatgcagataacgtcaac
gactctacatttactggctttcttctctaccatgataccaactga

DBGET integrated database retrieval system