KEGG   Mus caroli (Ryukyu mouse): 110311924
Entry
110311924         CDS       T05910                                 

Gene name
Ifnar2
Definition
(RefSeq) interferon alpha/beta receptor 2
  KO
K05131  interferon receptor 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04060  Cytokine-cytokine receptor interaction
mcal04151  PI3K-Akt signaling pathway
mcal04217  Necroptosis
mcal04380  Osteoclast differentiation
mcal04620  Toll-like receptor signaling pathway
mcal04621  NOD-like receptor signaling pathway
mcal04630  JAK-STAT signaling pathway
mcal04650  Natural killer cell mediated cytotoxicity
mcal05160  Hepatitis C
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110311924 (Ifnar2)
   04151 PI3K-Akt signaling pathway
    110311924 (Ifnar2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110311924 (Ifnar2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110311924 (Ifnar2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110311924 (Ifnar2)
   04621 NOD-like receptor signaling pathway
    110311924 (Ifnar2)
   04650 Natural killer cell mediated cytotoxicity
    110311924 (Ifnar2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110311924 (Ifnar2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110311924 (Ifnar2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110311924 (Ifnar2)
   05171 Coronavirus disease - COVID-19
    110311924 (Ifnar2)
   05164 Influenza A
    110311924 (Ifnar2)
   05162 Measles
    110311924 (Ifnar2)
   05168 Herpes simplex virus 1 infection
    110311924 (Ifnar2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110311924 (Ifnar2)
   05169 Epstein-Barr virus infection
    110311924 (Ifnar2)
   05165 Human papillomavirus infection
    110311924 (Ifnar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcal04050]
    110311924 (Ifnar2)
Cytokine receptors [BR:mcal04050]
 Interleukin receptor families
  IFN receptor family
   110311924 (Ifnar2)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 110311924
NCBI-ProteinID: XP_021041168
Ensembl: MGP_CAROLIEiJ_G0020957
UniProt: A0A6P5R7Y0
LinkDB
Position
16
AA seq 492 aa
MSLETIPPSAFDGYPDELCTINITIRNSRLILSWELKNKSGPSANYTLWYTVMSKDENLT
KVKNCSDTTKSSCDVTDKWLEGMESYVAIVIVRRGDLTVCRCSDYMVPANAPLEPPEFEI
VGFTDHINVTMEFPPVTSKIIRERMRSTPFVIKEQIGDSVRKKHEPKVNNVTGNFTFVLR
DLLPKTNYCVSLYFDDDPAIKSPLKCIVLQPGQESGLSEFAKVGGITSCLIVMVFVSTII
ILKRIGYICLKDNLPNVLNFRHFLTWIFPERSPSEAIDRLEIIPTNKKKRLWNYDYEDGS
DSDEEVPTASVTGYTMHGLTGKPLQQTSDTSASPEDPLHEEDSGAEESDEAGAGAGAEPQ
LPTEAGAGPSEDPSGPYERRKSVLEDSFPREDNSSMDEPGDNIIFNVNLNSVFLRVLHDE
DASETLSLAEDTILLDEGPHRTESDLRIAGGDRTQPPLPSLPSQDLWTEDGSSEKSDTSD
SDADVGDGYIMR
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgagcctagagactatcccaccgtctgcttttgatgggtatccagatgaactgtgcact
ataaacataaccatacgaaattcccggctaattttatcctgggaattaaaaaacaagtct
gggccatccgctaactacaccctctggtacacagtcatgagcaaagacgaaaatctgacg
aaggttaagaactgttcagacaccacgaagtcatcatgtgacgtgacagataagtggttg
gagggcatggagagctacgtcgccatcgtcatagtgcgtagaggggacttgaccgtgtgc
cgctgctcagactacatggtgcctgcaaacgctcctcttgagccaccagaatttgagatc
gttggctttacagaccacataaacgtgacgatggaatttccacctgtcacttccaagata
atccgggaaaggatgaggtctacaccctttgtcatcaaagagcagataggggacagcgtt
aggaagaagcacgagcccaaagtgaataatgtcactgggaacttcacatttgtccttaga
gacttacttccaaagacaaactactgtgtatctctttattttgatgatgaccccgcaata
aaatctcccttaaaatgcatcgtccttcagcctggccaggaatcaggattatcagaattt
gccaaagtaggaggaattacttcgtgtttgatagtgatggttttcgtgagcactatcata
atactgaaacggattggttatatatgcctaaaagacaatttgcccaatgtcttgaacttc
cgtcactttttaacctggatattccctgaacggtcaccttcagaagccatcgatcggctg
gaaatcatccccacaaacaagaagaagagactgtggaattacgattatgaggatggcagt
gacagtgacgaagaggtccccacagcaagtgtcactggctacaccatgcatggactgacg
ggcaagcctctgcagcaaacctctgacacctcagccagccccgaggatcccctgcatgaa
gaagattcaggggctgaggaatctgatgaagctggagcaggggctggagctgagccacaa
ctccccacagaggcgggagcggggccttcagaagacccaagtggcccctatgagagaaga
aagagtgtgctcgaggactcattccccagggaggacaacagctccatggatgagcctggg
gacaacattatcttcaacgtgaacttaaactctgtgtttctgagggttctccatgatgaa
gatgcctcagagacgttatctctcgcagaagacaccatcctcctagacgaaggtccccac
aggacagagtcagaccttcggatagctggtggggacaggacacagccgcccctccccagc
cttccttcccaggatctatggactgaagatgggtcatctgagaaatcagacacctcggat
tccgacgctgatgtgggggacggctacatcatgagatga

DBGET integrated database retrieval system