KEGG   Mus caroli (Ryukyu mouse): 110312162
Entry
110312162         CDS       T05910                                 

Gene name
Tsc1
Definition
(RefSeq) hamartin
  KO
K07206  tuberous sclerosis 1
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04072  Phospholipase D signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04211  Longevity regulating pathway
mcal04218  Cellular senescence
mcal04714  Thermogenesis
mcal04910  Insulin signaling pathway
mcal05163  Human cytomegalovirus infection
mcal05165  Human papillomavirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    110312162 (Tsc1)
   04151 PI3K-Akt signaling pathway
    110312162 (Tsc1)
   04152 AMPK signaling pathway
    110312162 (Tsc1)
   04150 mTOR signaling pathway
    110312162 (Tsc1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110312162 (Tsc1)
  09143 Cell growth and death
   04218 Cellular senescence
    110312162 (Tsc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110312162 (Tsc1)
  09149 Aging
   04211 Longevity regulating pathway
    110312162 (Tsc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    110312162 (Tsc1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    110312162 (Tsc1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    110312162 (Tsc1)
   05163 Human cytomegalovirus infection
    110312162 (Tsc1)
   05165 Human papillomavirus infection
    110312162 (Tsc1)
SSDB
Motif
Pfam: Hamartin zf-C2H2_assoc ATG16
Other DBs
NCBI-GeneID: 110312162
NCBI-ProteinID: XP_021041383
Ensembl: MGP_CAROLIEiJ_G0023356
UniProt: A0A6P5REK8
LinkDB
Position
2
AA seq 1155 aa
MAQLANIGELLSMLDSSTLGVRDDVTTIFKESLNSERGPMLVNTLVDYYLETNSQPVLHI
LTTLQEPHDKHLLDKMNEYVGKAATRLSILSLLGHVVRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVTEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENVETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKTLETHDVVIECAKISLDPTEASYEDGYCVSHQLSACFPHRSADVTTSPYVDT
QNSYGGSTSTPSSSSRLMLFSPPGQLPQSLSSPSTRLLPEPLQASLWSPSAVCGMTTPPT
SPGNVPADLSHPYSKAFGTTGGKGTPSGTPATSPPPAPPCPQDDCVHGPAAQASATAPRK
EERTDSSRPYLHRQSNDRGLEDPPGSTGSVTLRNLPDFLGDLASEEDSIEKDKEEAAISK
ELSEITTAEADPVVPRGGFDSPFYRDSLSGSQRKTHSAASGTQGSSVNPEPLHSSLDKHG
PDTPKQAFTPIDPPSGSADASPAGDRDRQTSLETSILTPSPCKIPPQRGVSFGSGQLPPY
DHLFEVALPKTACHFVSKKTEELLKKVKGNPEEDCVPSTSPMEVLDRLIEQGAGAHSKEL
SRLSLPSKSVDWTHFGDEIRTLRDQLLLLHNQLLYERFKRQQHALRNRRLLRKVIRAAAL
EEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYSQLQEQRDTMVTQLHSQIRQLQHDREEF
YNQSQELQTKLEDCRNMIAELRVELKKANNKVCHTELLLSQVSQKLSNSESVQQQMEFLN
RQLLVLGEVNELYLEQLQSKHPDTTKEVEMMKTAYRKELEKNRSHLLQQNQRLDASQRRV
LELESLLAKKDHLLLEQKKYLEDVKSQASGQLLAAESRYEAQRKITRVLELEILDLYGRL
EKDGRLRKLEEDRAEAAEAAEERLDCCSDGCTDSLVGHNEEASGHNGETRTSRPGGTRAS
CGGRVTGGSSSSSSELSTPEKPPSQRFSSRWEPAIGEPSSSIPTTVGSLPSSKSFLGMKA
RELFRNKSESQCDEDSVTMSSSSLSETLKTEPGKDLGTENKTSLSLDAPHPSSPNSDSVG
QLHIMDYNETHPEHS
NT seq 3468 nt   +upstreamnt  +downstreamnt
atggcccagttagccaacattggggagctgctctccatgctggactcttccacactgggt
gttcgagatgacgtgacaaccatcttcaaggagtccctcaattctgaacgtgggcctatg
cttgtcaacacgttggtggattattacctggaaaccaattctcagccggtattgcacatc
ctgaccaccttgcaggagccacatgataagcacctcttggacaaaatgaatgagtatgta
ggcaaagctgctacccgtttatccatcctctcgctgctggggcatgttgtgaggctgcag
ccatcttggaagcataagctctctcaagcacctcttctgccttctttattgaaatgtctc
aagatggacactgatgttgtggtcctcacaactggtgtcttggtgttgatcaccatgctc
ccgatgatcccgcagtcagggaagcagcaccttctcgacttctttgacatctttggccgt
ctctcgtcatggtgcctgaagaaaccaggccacgtgacagaagtgtacctggtccatctt
catgccagtgtttatgctctctttcaccgcctttatgggatgtacccgtgtaacttcgtc
tccttcctgcgctctcactacagtatgaaagaaaacgtggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcacccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagacattagaaactcatgatgttgtaatagagtgtgcc
aaaatctctctggaccctacagaagcctcatatgaagatggctattgtgtgtctcaccag
ctctctgcctgcttccctcaccgttcagctgatgtcaccaccagcccttatgtggacaca
cagaatagctatgggggttctacttccaccccttcctccagctctcggctgatgttgttc
agtccacctgggcagctacctcagagtttgagttccccatcaacacggctgttacctgag
ccgctgcaagctagtctctggagcccgtctgcagtctgtggtatgaccactcctcctacg
tctcctggaaatgtcccagctgatttgtcacatccgtatagtaaagcttttggtaccact
ggtggaaaaggaactccttcaggaaccccagcgacctctcctcctccagccccgccttgt
ccccaagatgactgtgtgcatggtccagcagcccaggcctcagccacagcccccaggaag
gaagaaagaacagattcctcaaggccttaccttcacagacagtcaaacgaccgaggatta
gaggatccacctggaagcacaggttctgttactctgaggaacctacctgatttcctaggt
gatctggcttctgaggaagacagcatagagaaagataaggaagaagctgcaatatctaaa
gagctttctgagatcactactgcagaggcggatcctgtagttcctcgagggggctttgac
tctcccttctaccgagacagtctctctggttctcagcggaagactcattcggcagcctct
gggactcagggctccagcgtgaaccctgagcctttgcactcctccctggacaaacatggg
cctgacacaccaaagcaagcctttactcccatagacccaccctctggcagtgctgatgcc
agtcccgctggggacagggatcgccagacttctctggagaccagtatcctcactcccagc
ccttgcaaaattccacctcagaggggagtgagctttggaagtgggcagcttcccccatat
gatcatctctttgaggtggccttgccaaagactgcctgtcactttgtcagcaagaagact
gaggagctgttgaagaaagtgaaaggaaaccctgaggaagactgtgtgccctctacctcc
ccaatggaagtactggacagactgatagagcagggagcaggtgcgcacagcaaggagctg
agcaggttgtccttgcccagcaagtctgttgactggacccactttggagatgagatccgg
accctccgagaccagttgcttttactgcacaatcagttgctgtatgagcgcttcaagcgg
cagcagcatgcactcaggaacagaaggctcctgcgcaaggtgatccgagcagcggctctg
gaggaacacaatgcagcaatgaaagatcagttgaagttacaagagaaggacatccagatg
tggaaggtgagtctgcagaaagaacaagcccgatacagtcagcttcaggaacaacgtgac
accatggtgacccaactgcatagccagatcagacagctacagcatgaccgagaggaattc
tacaaccagagtcaggagttacagacaaagctggaggactgcagaaacatgattgcggag
cttcgggtggagctgaagaaggctaacaacaaggtgtgccacactgagctgctgctcagc
caggtctctcagaagctttccaacagtgagtcagtgcagcagcagatggagttcttgaat
aggcagctcctggtgctcggggaggtcaatgagctgtacctggagcagctgcagagcaag
catcctgacaccaccaaggaagtagaaatgatgaaaactgcatatcggaaagaactagag
aaaaacagaagccaccttctccagcagaaccaaaggttggatgcctcacagaggcgagtt
ttggaactggaatctcttctggccaagaaagaccaccttctcctagagcagaagaaatat
cttgaggatgtcaagagtcaggcgagtggacagctgctggctgcagagagcaggtatgag
gctcagagaaagatcacccgggtgttggaactggagatcctagacttatatggcaggttg
gaaaaagatggccgcctacggaaactagaagaggacagagcagaggcggcagaggcagca
gaagagaggcttgactgttgtagtgatggatgcacagattccttggtaggacataatgaa
gaggcttctggtcacaacggtgagaccaggacctccagacctggtggcacccgggccagc
tgtggaggtagagtcactggcggcagcagcagcagcagcagtgagctttccactccagag
aaacccccgagccagaggttcagcagccggtgggaacctgccataggcgagccctccagc
agcatccccaccacggttggctcacttcccagttccaaaagcttcctgggcatgaaggcc
cgggagctgttccgtaataagagcgagagccagtgtgatgaggacagcgtgaccatgagt
agcagcagcctttctgagaccctgaagacagaaccgggcaaggacttgggcacagaaaac
aagacttccctgagtctagatgccccacacccatcttccccaaactcagacagtgtgggg
cagctccacatcatggactacaatgagactcatcctgagcacagctga

DBGET integrated database retrieval system