KEGG   Mus caroli (Ryukyu mouse): 110312307
Entry
110312307         CDS       T05910                                 

Gene name
Eif2ak2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04217  Necroptosis
mcal05010  Alzheimer disease
mcal05160  Hepatitis C
mcal05162  Measles
mcal05164  Influenza A
mcal05165  Human papillomavirus infection
mcal05167  Kaposi sarcoma-associated herpesvirus infection
mcal05168  Herpes simplex virus 1 infection
mcal05169  Epstein-Barr virus infection
mcal05171  Coronavirus disease - COVID-19
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110312307 (Eif2ak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110312307 (Eif2ak2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312307 (Eif2ak2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110312307 (Eif2ak2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    110312307 (Eif2ak2)
   05171 Coronavirus disease - COVID-19
    110312307 (Eif2ak2)
   05164 Influenza A
    110312307 (Eif2ak2)
   05162 Measles
    110312307 (Eif2ak2)
   05168 Herpes simplex virus 1 infection
    110312307 (Eif2ak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110312307 (Eif2ak2)
   05169 Epstein-Barr virus infection
    110312307 (Eif2ak2)
   05165 Human papillomavirus infection
    110312307 (Eif2ak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110312307 (Eif2ak2)
   01009 Protein phosphatases and associated proteins [BR:mcal01009]
    110312307 (Eif2ak2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mcal03019]
    110312307 (Eif2ak2)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110312307 (Eif2ak2)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   110312307 (Eif2ak2)
Protein phosphatases and associated proteins [BR:mcal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110312307 (Eif2ak2)
Messenger RNA biogenesis [BR:mcal03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     110312307 (Eif2ak2)
SSDB
Motif
Pfam: Pkinase dsrm PK_Tyr_Ser-Thr DND1_DSRM
Other DBs
NCBI-GeneID: 110312307
NCBI-ProteinID: XP_021041470
Ensembl: MGP_CAROLIEiJ_G0021889
LinkDB
Position
17
AA seq 471 aa
MASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAEGRSKQ
EARNAAAKLAVDILDNENKVDCHTNASEQGLFVGNYIGLVNSFAQKKKLSVNYEQCEPNS
ELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSSSVVTSTFS
GFSSSSSMTSNGVSQSAPGNFSSENVFTNGLGENKRKSGIQKPCDDVAGDTISILSRFNS
DFEDIEEIGLGGFGQVFKAKHRIDGKTYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHS
CWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQI
VTGVECIHSKGLIHRDLKLYLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFKSLRNG
IFSNDIFDNKEISLLKKLLSEKPEDRPKTSEILKTLAEWRDISEKKKRNTC
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccagtgatactccaggtttctacatggacaaacttaataaataccgccagatgcac
ggagtagccattacgtataaagaacttagtacttcgggacctccacatgaccgaaggttt
acatttcaagttttaatagacgagaaggaatttccagaagccgaaggtagatcaaagcag
gaggcaagaaacgctgcagccaaattagctgttgatatacttgataacgaaaacaaggtg
gattgtcacacgaatgcatctgaacagggcttattcgttggtaactacataggccttgtc
aatagttttgcccagaagaaaaagctgtctgtaaattatgaacagtgtgagcccaactct
gagttgcctcaaagatttatttgtaaatgcaaaattgggcagacgatgtatggtactggt
tcaggtgttaccaaacaggaggcaaagcagttggctgcgaaagaagcctatcagaagctg
ttaaagagcccnccgaaaactgccggaacatcctctagcgttgtcacatctacattcagt
ggcttttccagcagctcgtctatgacaagtaacggtgtttcccagtcagcacctggaaat
ttttcctcagagaacgtgtttacgaacggtctcggagaaaataaaaggaaatcaggaata
caaaagccctgtgatgatgtagcaggcgacacgatatcaatcttatctaggtttaacagc
gattttgaagacatagaagaaattggcttaggtggatttggtcaagttttcaaagcgaaa
cacagaattgatggaaagacgtacgctattaagcgcgttaaatataacacggagaaggcg
gagcacgaagtacaagcgctggcagaactcaatcacgtcaacattgtccaataccatagt
tgttgggagggagttgactatgatcctgagcacagcatgagtgatacaagtcgatacaaa
acccggtgcctctttattcaaatggaattctgtgataaaggaactttggagcaatggatg
agaaacagaaatcagagtaaagtggacaaagctttgattttggacttatatgaacaaatc
gtgacaggagtggagtgtatacactcgaaagggttaattcacagagatcttaagttatat
ttaaagcactatggaaaggaagtggacatctttgctttgggccttattctagctgaactt
cttcacacgtgcttcacggagtcagagaaaataaagtttttcaaaagcctaagaaacggc
atcttctccaatgatatattcgacaacaaagaaataagccttctaaaaaaattactctca
gagaaacccgaggaccgacctaagacatctgaaatcctgaagaccttggctgaatggagg
gacatctcagagaaaaagaaaagaaacacatgttag

DBGET integrated database retrieval system