KEGG   Mus caroli (Ryukyu mouse): 110312395
Entry
110312395         CDS       T05910                                 

Gene name
Pdpk1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1 isoform X1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal01524  Platinum drug resistance
mcal03320  PPAR signaling pathway
mcal04068  FoxO signaling pathway
mcal04071  Sphingolipid signaling pathway
mcal04140  Autophagy - animal
mcal04150  mTOR signaling pathway
mcal04151  PI3K-Akt signaling pathway
mcal04152  AMPK signaling pathway
mcal04210  Apoptosis
mcal04510  Focal adhesion
mcal04660  T cell receptor signaling pathway
mcal04664  Fc epsilon RI signaling pathway
mcal04722  Neurotrophin signaling pathway
mcal04910  Insulin signaling pathway
mcal04919  Thyroid hormone signaling pathway
mcal04931  Insulin resistance
mcal04960  Aldosterone-regulated sodium reabsorption
mcal05145  Toxoplasmosis
mcal05205  Proteoglycans in cancer
mcal05213  Endometrial cancer
mcal05215  Prostate cancer
mcal05223  Non-small cell lung cancer
mcal05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110312395 (Pdpk1)
   04071 Sphingolipid signaling pathway
    110312395 (Pdpk1)
   04151 PI3K-Akt signaling pathway
    110312395 (Pdpk1)
   04152 AMPK signaling pathway
    110312395 (Pdpk1)
   04150 mTOR signaling pathway
    110312395 (Pdpk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110312395 (Pdpk1)
  09143 Cell growth and death
   04210 Apoptosis
    110312395 (Pdpk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110312395 (Pdpk1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    110312395 (Pdpk1)
   04664 Fc epsilon RI signaling pathway
    110312395 (Pdpk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110312395 (Pdpk1)
   03320 PPAR signaling pathway
    110312395 (Pdpk1)
   04919 Thyroid hormone signaling pathway
    110312395 (Pdpk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110312395 (Pdpk1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110312395 (Pdpk1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110312395 (Pdpk1)
   05231 Choline metabolism in cancer
    110312395 (Pdpk1)
  09162 Cancer: specific types
   05215 Prostate cancer
    110312395 (Pdpk1)
   05213 Endometrial cancer
    110312395 (Pdpk1)
   05223 Non-small cell lung cancer
    110312395 (Pdpk1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    110312395 (Pdpk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110312395 (Pdpk1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110312395 (Pdpk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcal01001]
    110312395 (Pdpk1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcal04131]
    110312395 (Pdpk1)
Enzymes [BR:mcal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     110312395 (Pdpk1)
Protein kinases [BR:mcal01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   110312395 (Pdpk1)
Membrane trafficking [BR:mcal04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    110312395 (Pdpk1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 110312395
NCBI-ProteinID: XP_021041615
Ensembl: MGP_CAROLIEiJ_G0021173
UniProt: A0A6P5R2R1
LinkDB
Position
17
AA seq 559 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRSQTEPGSSPGIPSGVSRQGSTMDGTTAEAR
PSTNPLQQHPAQLPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRH
IIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSF
DETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQA
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKL
EYHFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFETITWENLHQQTPPK
LTAYLPAMSEDDEDCYGNYDNLLSQFGFMQVSSSSSSHSLSTVEASLPQRSGSNIEQYIH
DLDTNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCR
KIQEVWRQQYQSNPDAAVQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgctgtgcccattcagtccagtgtggtgcta
tgttcctgcccatccccatcaatggtgaggtcccagactgagcccggctcgtcccctggc
attcctagtggtgttagcaggcagggatccaccatggacggcaccacagctgaagcccga
ccaagtaccaaccccttgcagcagcaccctgcccagctgccaccacagcctcgcaagaaa
cgccctgaagacttcaagtttgggaaaattcttggcgagggctctttttcaacagtggtt
ctggcccgagaactggccacttccagagaatatgctattaaaattctggagaaacgtcat
attataaaagaaaacaaagttccgtatgtaactagagagagagatgtgatgtcacgcctg
gatcaccccttctttgtgaaactttattttacatttcaggacgacgaaaagctgtatttt
ggccttagttatgccaaaaatggagagctacttaaatacatccgcaaaattggctcattt
gatgagacctgtacccggttttacacggctgagattgtgtctgctttagagtacttgcat
ggcaagggcatcattcacagagaccttaaaccagaaaacattttgttaaatgaagacatg
cacatccagatcacagattttggaacagcaaaagtgttatccccagagagcaaacaagcc
agggccaactcatttgtaggaacagcacagtatgtttctccagagctgctcacagagaag
tcggcgtgtaaaagttcagacctttgggcccttggatgtataatctatcagctcgtggca
ggactcccaccattcagagccggaaatgaatatcttatatttcagaagatcattaagctg
gaatatcatttcccagaaaaattcttccctaaggcaagagatcttgtggaaaaactcttg
gttttagatgccacaaagcgtttaggatgtgaagagatggaagggtacgggcctctcaaa
gctcatccattctttgagaccatcacttgggagaatttgcaccagcagacacctccgaag
ctcacagcttacttaccagccatgtcagaggatgatgaagactgctatggcaactacgac
aatctcctgagccagtttggcttcatgcaggtgtcatcctcctcctcttcccactccctg
tctacggtggaagccagcctgccccagaggtcgggcagcaacatagagcagtacatccat
gatttggacactaactcttttgaactagacttacagttttcagaagatgaaaaaaggttg
ttattggaaaagcaagccggtggaaacccttggcaccagtttgtagaaaataatctaata
ttaaaaatgggcccagtggataagcgaaagggtttatttgcaagacgacgacagttatta
ctcacagaagggccacatttatattatgttgatcctgtcaacaaggtcttgaaaggtgaa
atcccatggtcacaagaactccgaccagaagccaagaattttaaaactttctttgtccac
acgcctaacaggacgtactacctgatggatccaagcgggaatgctcacaagtggtgcaga
aagatccaggaggtttggaggcagcagtaccagagcaatccagatgctgctgtgcagtga

DBGET integrated database retrieval system