KEGG   Mus caroli (Ryukyu mouse): 110312495
Entry
110312495         CDS       T05910                                 

Gene name
Runx2
Definition
(RefSeq) runt-related transcription factor 2 isoform X1
  KO
K09278  runt-related transcription factor 2
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110312495 (Runx2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110312495 (Runx2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110312495 (Runx2)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    110312495 (Runx2)
SSDB
Motif
Pfam: Runt RunxI DUF2722 TFIIA Suf DUF4770 Spt20 DUF2828 BAF1_ABF1 Trp_oprn_chp eIF-3_zeta DUF3488 EPL1 TERB2
Other DBs
NCBI-GeneID: 110312495
NCBI-ProteinID: XP_021041793
Ensembl: MGP_CAROLIEiJ_G0021639
UniProt: A0A6P5R9T8
LinkDB
Position
17
AA seq 594 aa
MLHSPHKQPQNHKCGANFLQEDCKKALAFKWLISAGHYQPPRPTKSFKAASSIYNRGHKF
YLEKKGGTMASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQ
QQQQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIA
DHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAE
LRNASAVMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREP
RRHRQKLDDSKPSLFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITD
PRQAQSSPPWSYDQSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATS
DFCLWPSSLSKKSQAGASELGPFSDPRQFPGISSLTESRFSNPRMHYPATFTYTPPVTSG
MSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSASYQFPMVPGGDRSPS
RMVPPCTTTSNGSTLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgcttcattcgcctcacaaacaaccacagaaccacaagtgcggtgcaaactttctccag
gaagactgcaagaaggctctggcgtttaaatggttaatctctgcaggtcactaccagcca
ccgagaccaaccaagtcatttaaggctgcaagcagtatttacaacagagggcacaagttc
tatctggaaaaaaaaggagggactatggcgtcaaacagcctcttcagcgcagtgacaccg
tgtcagcaaagcttcttttgggatccgagcaccagccggcgcttcagccccccctccagc
agcctgcagcccggcaagatgagcgacgtgagcccggtggtggctgcgcagcagcagcaa
cagcagcagcagcagcaacagcagcagcaacaacagcaacagcaacaacagcagcagcag
cagcagcaggaggcggccgcagcagcagcggcggcagcggcggcggcagcagcggcggcg
gccgcagtgccccggttgaggccgccgcacgacaaccgcaccatggtggagatcatcgcg
gaccacccggccgaactggtccgcaccgacagtcccaacttcctgtgctccgtgctgccc
tcgcactggcggtgcaacaagaccctgcccgtggccttcaaggttgtagccctcggagag
gtaccagatgggactgtggttactgtcatggccgggaacgatgagaactactccgccgag
ctccgaaatgcctctgctgttatgaaaaaccaagtagccaggttcaacgatctgagattt
gtgggccggagcggacgaggcaagagtttcaccttgaccataacagtcttcacaaatcct
ccccaagtggccacttaccacagagctattaaagtgacagtggacggtccccgggaacca
agaaggcacagacagaagcttgatgactctaaacctagtttgttctctgatcgcctcagt
gatttagggcgcattcctcatcccagtatgagagtaggtgtcccgcctcagaacccacgg
ccctccctgaactctgcaccaagtccttttaatccacaaggacagagtcagattacagat
cccaggcaggcacaatcttccccaccgtggtcctatgaccagtcttacccctcctatctg
agccagatgacatccccatccatccactccaccacgccgctctcttccacacggggcacc
gggctacctgccatcaccgacgtgcccaggcgtatttcagatgatgacactgccacctct
gacttctgcctctggccttcctctctcagtaagaagagccaggcaggtgcttcagaactg
ggccctttttcagaccccaggcagttcccaggcatttcatccctcactgagagccgcttc
tccaacccacgaatgcactacccagccacctttacttataccccgccagtcacgtcaggc
atgtccctcggcatgtccgccaccactcactaccacacgtacctgccaccaccctacccc
ggctcttcccaaagccagagtggacccttccagaccagcagcactccatatctctactat
ggtacttcgtcagcatcctatcagttcccaatggtacccgggggagaccggtctccttcc
aggatggtcccgccatgcaccaccacctcgaatggcagcacgctattaaatccaaatttg
cctaaccagaatgatggtgttgacgctgacggaagccacagcagttccccaactgttttg
aattctagcggcagaatggatgagtctgtttggcggccatattga

DBGET integrated database retrieval system