KEGG   Mus caroli (Ryukyu mouse): 110312537
Entry
110312537         CDS       T05910                                 

Gene name
Atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
mcal  Mus caroli (Ryukyu mouse)
Pathway
mcal04022  cGMP-PKG signaling pathway
mcal04141  Protein processing in endoplasmic reticulum
mcal04151  PI3K-Akt signaling pathway
mcal04211  Longevity regulating pathway
mcal04261  Adrenergic signaling in cardiomyocytes
mcal04668  TNF signaling pathway
mcal04728  Dopaminergic synapse
mcal04911  Insulin secretion
mcal04915  Estrogen signaling pathway
mcal04918  Thyroid hormone synthesis
mcal04925  Aldosterone synthesis and secretion
mcal04926  Relaxin signaling pathway
mcal04927  Cortisol synthesis and secretion
mcal04928  Parathyroid hormone synthesis, secretion and action
mcal04934  Cushing syndrome
mcal04935  Growth hormone synthesis, secretion and action
mcal05020  Prion disease
mcal05030  Cocaine addiction
mcal05031  Amphetamine addiction
mcal05034  Alcoholism
mcal05161  Hepatitis B
mcal05163  Human cytomegalovirus infection
mcal05166  Human T-cell leukemia virus 1 infection
mcal05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcal00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110312537 (Atf6b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    110312537 (Atf6b)
   04022 cGMP-PKG signaling pathway
    110312537 (Atf6b)
   04151 PI3K-Akt signaling pathway
    110312537 (Atf6b)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    110312537 (Atf6b)
   04915 Estrogen signaling pathway
    110312537 (Atf6b)
   04926 Relaxin signaling pathway
    110312537 (Atf6b)
   04935 Growth hormone synthesis, secretion and action
    110312537 (Atf6b)
   04918 Thyroid hormone synthesis
    110312537 (Atf6b)
   04928 Parathyroid hormone synthesis, secretion and action
    110312537 (Atf6b)
   04925 Aldosterone synthesis and secretion
    110312537 (Atf6b)
   04927 Cortisol synthesis and secretion
    110312537 (Atf6b)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110312537 (Atf6b)
  09156 Nervous system
   04728 Dopaminergic synapse
    110312537 (Atf6b)
  09149 Aging
   04211 Longevity regulating pathway
    110312537 (Atf6b)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110312537 (Atf6b)
  09164 Neurodegenerative disease
   05020 Prion disease
    110312537 (Atf6b)
  09165 Substance dependence
   05030 Cocaine addiction
    110312537 (Atf6b)
   05031 Amphetamine addiction
    110312537 (Atf6b)
   05034 Alcoholism
    110312537 (Atf6b)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110312537 (Atf6b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110312537 (Atf6b)
   05161 Hepatitis B
    110312537 (Atf6b)
   05163 Human cytomegalovirus infection
    110312537 (Atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mcal03000]
    110312537 (Atf6b)
Transcription factors [BR:mcal03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110312537 (Atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB Docking
Other DBs
NCBI-GeneID: 110312537
NCBI-ProteinID: XP_021041869
Ensembl: MGP_CAROLIEiJ_G0021471
LinkDB
Position
17
AA seq 706 aa
MVGGGGKMAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQAQLYRCVEQDV
PFDSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSHLSTEPPSQVP
GVGEVLHVKMESLAPPLCLLGDDPASPFETVQITVGSASDDLPDIQTKLEPASPSSSVHS
EASLLSADSPSQPFIGEEVLEVKTESPSPPGCLLWDVPASSLGAVQISMGPSPDSSSGKA
PATRKPPLQPKPVVLTTVPVPPRAGPTSAAVLLQPLVQQPAVSPVVLIQGAIRVQPEGPA
PAAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEAR
LQAVLADNQQLRRENAALRRRLEALLAENSGLKLGSGNRKVVCIMVFLLFIAFNFGPVSI
SEPPPAPMSPRMSREEPRPQRHLLGFSEPGPAHGIEPLQEAARSPEEQQPSSAGRPSFRN
LTAFPGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPHRAQE
RQKSQLRKKSPPVKPVPTQPPGPPERDPVGQLQLYRHPSRSQPEFLDAIDRREDTFYVVS
FRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETVSGRGPPGDYEEMMQIECEVMDTRVIH
IKTSTVPPSLRKQPSPSPGNTTGGPLPGSAASPAHQASQPLYLNHP
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggtggggggtggggggaagatggcggagctgatgctcctcagcgagatcgccgacccg
acgcgcttcttcaccgacaacctgctgagtccggaggattgggacagcaccttgtacagt
ggcctggatgaagtggccgaggaacaggcacagttgtatcgttgcgtggagcaggatgtc
ccgtttgacagcagctctctggatgtggggatggatgtcagcccccctgagcccccttgg
gaccctctacccatcttcccagatcttcaggtgaagtctgagccatcctctccctgctcg
tcctcctccctcagctcagagtcctcacatctttccacagagccccccagccaggtccct
ggcgtaggggaggtgctgcatgtgaagatggagtccctggcacccccactctgcctgctg
ggggatgacccagcatccccctttgaaacagtccagatcactgtgggctctgcctctgat
gatcttccagatatccagaccaagctggaacctgcctctccgtcttcttctgtccactct
gaggcctccttgctgtcagccgactctcccagtcagccttttataggagaggaggttctg
gaagtgaagacagagtctccgtcccctccagggtgcctcctgtgggatgtcccagcctct
tcgctcggagctgtccagatcagcatgggtccatcccctgatagttcctcagggaaagct
ccagccactcggaagcctccactgcagcccaagcctgtggtactaaccacagttccggtg
ccacctagagctgggcctaccagcgctgctgtcctcctgcaacccctggtccagcagcct
gcggtgtccccagtggtcctcatccaaggtgctatccgagtccagcctgaagggccagct
cctgcagctccacggcctgagaggaagagcattgttccagcccctatgccggggaactcc
tgcccgcctgaagtggatgcaaagctgttgaagcggcagcagcggatgatcaagaatcga
gagtcagcctgccagtcccgccgcaagaagaaagagtacctgcaaggcctggaggcccgg
ctgcaggctgtgctggcagacaaccagcagctgcgcagggagaacgctgccctccggcgg
cggctggaggccctactggcagagaacagcgggctcaagctggggtctggaaacaggaag
gttgtctgcatcatggtcttccttctcttcattgccttcaactttgggcctgtgagcatc
agcgagccgcccccagctcccatgtctcctcggatgagcagggaggagcctcgaccccag
aggcacctgctgggcttctcagaaccagggccagctcatggcattgaaccccttcaggaa
gccgcccggagccctgaggagcagcagcccagctctgcaggcaggcctagcttcagaaac
ctgacggccttccccgggggggccaaggagctgctgctgagagacctggaccagctcttc
ctctcctcggactgccgccatttcaaccgaactgagtctctgaggcttgctgatgagctg
agtggctgggtccaacgtcaccagagaggtcgacggaagatacctcacagggcccaggag
agacagaagtctcagctacggaagaagtctcctccagtgaaacctgtccccacccaacct
ccaggaccccctgaaagggaccccgtgggccagctgcagctctaccgccaccccagccgc
tcacagccggagtttctagacgcaattgaccggagggaagataccttctatgttgtctcc
ttccgaagggaccacctgctgctcccagccatcagccacaacaagacatccaggcccaag
atgtcactggtgatgccagccatggcccccaatgagaccgtgtcaggccggggcccccca
ggggactatgaggagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcac
atcaagacctctacggtgcccccctcgctccgaaagcagccgtccccgtccccgggcaat
accacaggtggccccttgccaggctctgcagctagtcctgctcatcaggcctcccagccc
ctctacctcaatcacccctga

DBGET integrated database retrieval system