KEGG   Mycoplasma canadense: MCAN360_0229Help
Entry
MCAN360_0229      CDS       T03615                                 

Gene name
sps1
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mcan  Mycoplasma canadense
Brite
KEGG Orthology (KO) [BR:mcan00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcan01001]
    MCAN360_0229 (sps1)
Enzymes [BR:mcan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MCAN360_0229 (sps1)
Protein kinases [BR:mcan01001]
 Serine/threonine kinases: Other
  Bacterial family
   MCAN360_0229 (sps1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Choline_kinase RIO1 Rax2 FTA2 Haspin_kinase DUF5383 ABC1 DUF4793
Motif
Other DBs
NCBI-ProteinID: BAP39460
UniProt: A0A077L5A5
LinkDB All DBs
Position
198632..199654
Genome map
AA seq 340 aa AA seqDB search
MFCYWSFKMIKILEKYKNLNKHFEDFKLIGSGGYGQVYSATFKKDKRRYAIKILTTPDVT
KKSVNLIRFKNECSVLAKIRSKNVVRIHGFYTSEDESYYSMELIEGIDLKTLIAKSKKIN
VEEAIRIAKEICQGLIDIHSSNVVHRDLKPSNILIEQNTNDVKLIDFGISIADETLKVTA
DNKTVGSIQYLAPEILKKKEKASFRSDIYAFGMILYEMLSGHPAFQGSDNHSILLMQINV
EIPPLEGVGKIIPQAVENIIIRCTAKDPSERYNNCKDILNDLENCLRIEAMNDKKLILES
KKEPKKNKKTLSLKWTIILISFAVAIIVVVLIVLIINKLI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
ctgttttgttactggagttttaaaatgattaaaatacttgaaaaatataaaaatttgaat
aaacattttgaagattttaaattaattggttcaggtggttatggccaagtttattctgca
acttttaaaaaagataagagaagatatgcaataaaaattttaacaacccctgatgttaca
aaaaaatctgtaaatttaattcgttttaagaacgaatgctctgtcttagcaaaaataaga
tctaaaaacgttgtaagaattcatggtttttatacttcagaagatgaatcttattattca
atggaattaattgaaggaatagatttaaaaaccttgattgcaaaaagtaaaaaaataaat
gttgaagaagcaataagaatagcaaaagaaatatgtcaaggtttaattgatattcattca
tctaacgttgttcatcgtgatttaaaaccaagcaatatattaattgaacaaaacactaac
gatgtcaaattaatagactttggaatttcgattgctgacgaaactcttaaagtaacggcg
gataataaaacagtcggatcaattcaatatttagctccagaaattttaaaaaagaaagaa
aaagcttcatttcgtagtgatatttatgcatttggaatgatattgtatgaaatgctttca
ggtcatccagcttttcaaggttcagataatcactcaatattattaatgcaaattaatgtt
gaaattccacctttagaaggtgtcggtaaaataataccacaggcagttgaaaatattatt
attcgatgcacggcaaaagatccatcagaaagatataataactgcaaagatattttaaat
gatttagaaaattgtttaagaattgaagcaatgaatgacaaaaagcttattttagagtca
aaaaaagaacctaaaaaaaacaaaaaaacattatcattaaaatgaacaataattttaatt
tcttttgcagtagcaattatagttgttgtcctaatagttttaattattaataaattaata
tag

DBGET integrated database retrieval system