KEGG   Mycoplasma canadense: MCAN360_0719Help
Entry
MCAN360_0719      CDS       T03615                                 

Definition
(GenBank) hypothetical protein
  KO
K20478  golgin subfamily B member 1
Organism
mcan  Mycoplasma canadense
Brite
KEGG Orthology (KO) [BR:mcan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcan04131]
    MCAN360_0719
Membrane trafficking [BR:mcan04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    MCAN360_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAP39760
UniProt: A0A077L638
LinkDB All DBs
Position
627165..636734
Genome map
AA seq 3189 aa AA seqDB search
MSKRTKKEKKALVIATTTLLLSTIGVGVLGGVSKHHRDSFINEKNNLISNLKSKIKELFE
TDKEKYEKLALAQNLSFNKPFIQYDVSELKKLIDILNTFIFNEVNNNLLEFKKNNDLFKE
ILHEISDKDFLKNLEARKAILSELNDLKDIYKLSEINRNNVIPKLKDIFNKKSYSSISFK
EAKDIIEKTLFSQLDTKISEIINNLDKNIAEYWSNINSNTKTSKEKEVILDTLNKYDQAL
KHANLIESPLKRNKYLKLIKSSPKDKIDDILQQVIKEANKDDIEERKSLIHQLSFLNKTA
SDEDKAKIENLLKNNLDPNFSKNANDLIKELEKKLENKSSLNYLINLKKENLKSILENNS
TLSEKQKELFKNKLEKTDLSNNEINLLQKTIFKEIELSRNKKYAKEIIDLLDEPEKTQFG
NNLALAKSIEKIREIEDKALEIYNKAKDEFDKHFDQNLENKDPKKQKILNDIIAINSVKA
FKDGIKAIDYAINENLNNLKMYALGVKDLLKLNDESEFVQKWVSNFDLNIKTFQKSKSIL
EIEKQLKDESLKEAILYKSKIVSQGNSNLNISKKISELETTLKNSLFNEKTLNDSFLKIN
EINLLIIKDSFSSINGNKTKIDNYKEKDQLLKFLDSNDTIDIFVAQAKYNLLSRVLLENE
IFKTNLDKLIKNSQFQNDEEIKKVISLLQETTEKNNDIKLPQKIVLDLVNKNFNEKSNEQ
KAKLINKVLTLLNVNTSFILNETEKINLETEGNNSDQELVKTLDEYDQKMILRYELASIY
NLANKNADLILKKSELKSLILNINSTKEQLESAINNVKEAFLRAINKSDKVREELIKKAS
TFNELFTINDDDTKNIENFNILLEALSPLVLSDISKFSEILSNLNEIEKINKEKLKEIIT
NLDEKDKDKNLEIEKLDSNEISKKLIEFNDKFNENKINILKDVESLDYDNPNKKGLLLLI
KESKNQKDLKNIKEIIKQKDVDHKLKKELLKLTEKFKNPNLTEEWIKKITLANDNESLEK
IKKDLISSISNEENRINELKALNKTLINKIQDPGKKDEFLKELNSDIHTINSFQSLQETV
NQFLTLETSKIEARKREIMNLVSKLSVNNSLKKTISESISKANLFTELKELEKQVKDSLN
KKKNEVKELLEKLGSPLKEKYIQDLNKLNTEIEFEELTDEINSILKNKKDALTKLINDII
NDSKNQNIKENYLDKLSKLETIDQFNSLQSDLEKNLNDLKTEVISWANKLSDSDDLILEI
NKKVNFKELNDKKLEIQAKLDNIYKNAQEKLKLLEGDDLYKDFSDKFNNLSNESHESELN
NFISKINELIEYQKNSINEMLNTIKDKNKKHEISSSIKNEIKLVDLKKLIKESQLQVNKE
KSIENIKKTLVYADSLDAYKELINSAKDEDQLKNIIKEVNNKENQLNDLKQNKIPLEEKI
KSLVNVDVEKQKELLEKLELLREDKLSEIENELNTHIQKQKDVVKEYLEEFLGNNPLKQE
LEIKLSSLNSETDILKIKEDLDNKLADLRKKIIDKIELLTNDKQKSQLLEQLNQNKTIEQ
INETLKQVEIQSSKENLLELLNNVKNIDKKEVLNSKIEAFNDNLKYNELHKEILDQIEKD
LAELELASFNVNQELNKLLSDQENKYDYFNQLIIKNSQSKEELEKITNEIKKYISDKKES
ILTKVEKLKEDIPSTINKYQEIKEEIIKNNDDFNISLYNKFNKEINSNFDLIKNLLVTDS
KFDTIYNSETSKLISELESLTIENSDVTKIISQHKKIVDLISNKILDLSKTFKSNKDVQE
QKYSRLIEKIVYENYENKQVENLMKINEQLTNELKKDNEKFEQLKQEILTLNNNLESNDK
TDLLTKINDSTNTYEKLLGLKTNIEEKINQYKEEIKQKITAKLEGYENLDTLLTTLDSKN
SYDDMKSVEEIANKAFIDKKNALISMLDSSLEQQEKNSFKNELEKDENTFSKLKDLEIKI
ELQQAKNKAKELIKNIEDPVKKAEFEEKINANNNISEINKLNKNISSYNKEQDNKLEDLK
NKAVEVINKLENSTTLKQEIKNASKQADVEKIIEDAKKKISDLKSDINKAFEKLNGHEDF
SSISQEDKNLENLNETELKEKLDSLEQAYNEKTANLKSKFEALNAQDNFPTQLNNYFNNN
EISIEKKIIALTAKETSSLLKDIENKSNILPDSLNKEYKDFLLSNSINENADLNEQKKLK
SIVESKLKELEQKNLEYKNEVDDIKLRIDDILSRVKDPFKLAEFNEQKQAIKFDNSPEIN
DLNKLESDINNYLNSLKTITNQLLSNLKSDDPKLLNVKQVLDSDQQTDEGYKEIRKELEL
YIEEYTRLSSSSVEKINGHQEYEILKNKILNNKSQTVNSEVKEKAERIFNNKTEIVKKEL
NDFDGEKNNLEQKLTSLNTYKELDQLEKEIQELAKNQVLDEINKLQIENQKTNFKSELAT
FSTVSQFNELKKRVKDKIIYNDAIAEAKAQAITHINKLWNSKKDELLNSFDSLDDVNVIN
SRKEDAIKALENKKKEILQKIKKMPFASQSQFNNDLEGKIGEDLVKFEENLNKISTKFEE
FEKILPSLTYINNRKSILESTWVHDKVNTEEKIKSLSDEYSSINQKYSDLNSEIQKLPIN
NSVRQKSENILNNNSKLKNISDIEILIAELKEEYSKLNNAYKETKKYADLLKNSSNHAQK
DLFNNENIILDKEELNEVSKIKTLEQEFKKQLSIEKFGFIIDYNNLNLLEINTNKNKKSN
LRQGRYYGIVGTGRTILSVLPALNKNEKYKMKVNNQWQDIGFDEKVKEGKTEIRLEKPLK
NSASFKDDYEFLELIGINKSYDSISYNQVAGKNNLSIKKDYSIKFNPSSYPLDNLVDGNK
NHVSRWDNWNYWGKPQDDNKITLTSNEEIKNYGKIDLWVRSGGMGSPNEHMPWGEYKWPH
SFTIRYSKDGKKWHDVEDQTVKYTEDLFVVDQNLKNKGILSENYNLPQKKSEISDEDLKI
KPDNMEYIIYFNIKFKPVEAKYIQVTWKASTRTINGNDNWTNIIGFSEFELGEVQKEAKK
VNIDDLNKLNNINPESDLPKNLRVLFKNTPNNPATHEIVEWKIQDEEINKKFQFNHLILK
GNKTLENLDFKEISVDLKSQINYYYTIEDLGNIKFAQNNVNKEAKIVKITIYRNDLNQEV
RTVYLKITK
NT seq 9570 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagaacaaaaaaggaaaagaaagctcttgtaatagcaactacaactctattg
ttatcaacaattggtgtgggcgtactcggtggggtgtctaagcatcatagagattctttt
atcaatgaaaaaaacaatttaattagtaaccttaagtctaaaattaaagaattatttgaa
actgataaagaaaaatatgaaaaattagctttagcccaaaatttatcatttaataaacct
tttattcaatatgatgtaagtgaattaaaaaaacttattgatatcttgaatacatttatt
tttaatgaagttaataataatcttttagagtttaaaaaaaataatgatctatttaaagaa
attttacacgaaatttccgataaagatttcttaaaaaatttagaagcacgtaaggcaatt
ctttctgaacttaatgatttaaaagatatttataaattaagcgaaatcaatagaaataac
gttattcctaaattaaaagatatctttaataaaaaaagttattcgtctatttcgttcaaa
gaagcaaaagatataattgaaaaaacattattttctcagttggatactaaaattagtgaa
attattaataacttagataaaaatattgccgaatattggtcaaatattaatagtaatact
aaaacctcaaaagaaaaagaggttattttagatacactaaacaaatatgatcaggcttta
aaacacgccaacttaattgaaagcccattaaaacgtaataaatatttaaaacttattaaa
agttcacctaaagataaaattgatgatattttacaacaagttattaaagaagctaataag
gatgatattgaagaaagaaaatcgctaattcatcaacttagttttttgaataaaacagca
tcagatgaagataaagcaaaaatagaaaacttattaaaaaataatttagatcctaatttt
tcgaaaaatgctaatgatttaattaaagaattagaaaaaaaattagaaaataaatcttct
ttaaattatctaatcaatcttaaaaaagaaaaccttaaatcaattcttgaaaataattca
acattaagcgaaaaacaaaaagaattatttaaaaataaattagaaaaaaccgatctttct
aataatgaaattaatttattacaaaagactatttttaaagaaattgagttgtcacgtaat
aaaaaatatgctaaagaaattattgatttattagatgaacctgaaaaaactcaatttgga
aacaatttagccttagcaaaaagtattgaaaaaataagagaaattgaagataaagctctt
gaaatttacaataaagccaaagatgaatttgataagcattttgatcaaaatcttgaaaat
aaggatcctaagaaacaaaaaatattaaacgatattattgcaataaatagtgttaaagca
tttaaagatggtattaaagcaatagattatgctattaatgaaaatcttaataatcttaaa
atgtatgcattaggagtaaaggatttattaaaactaaatgatgaaagcgagtttgttcaa
aaatgagtttctaattttgatttaaatataaaaacttttcaaaaatctaaatccatttta
gaaattgaaaaacaactgaaggatgaatcgttaaaagaagcaattttatataagtcaaaa
atcgtatctcaaggaaattctaatttaaatatttctaaaaagatttcagaattagaaaca
actttaaaaaattctttatttaatgaaaaaactttaaatgattcatttttaaaaataaat
gaaatcaacttattaataataaaagattcgttttcaagtattaatggtaataaaacaaaa
attgataattataaagaaaaagatcaattattaaaatttttagattctaacgatactatt
gatatttttgttgcgcaagcaaaatataatttattgtcaagagttttacttgaaaatgaa
atatttaagactaatcttgataagttaattaaaaattctcaatttcaaaatgatgaagaa
ataaaaaaagttatttctttattacaagaaactacagaaaaaaataatgatataaaatta
cctcaaaaaatagtccttgatttagtaaataaaaattttaatgagaaaagcaacgaacaa
aaagctaaattgattaacaaagttttaactttgcttaatgttaatacttcttttatttta
aatgaaacagaaaaaattaatttagaaacagagggtaataattcagatcaagaattagtt
aaaacattagatgaatatgaccaaaaaatgattttaagatatgaacttgcttcaatttat
aatttagcaaacaaaaatgctgatttaattcttaaaaaatctgagctaaaatcattaatt
ttaaatattaattcaacaaaagaacaactagaatcggcaataaataatgttaaagaggca
tttttaagagcaataaataaatcagataaagtacgcgaggaattaattaaaaaagcatca
acatttaatgaattatttacaataaatgacgacgatacaaagaatattgaaaactttaat
attttattagaagcattatcgcctttagtgttaagtgatatttcaaaatttagcgaaata
ttaagtaatttaaacgaaattgaaaaaataaacaaagaaaaacttaaagaaattattaca
aacttagatgaaaaagacaaggataagaatttagaaattgaaaaattagatagtaatgaa
atttcgaaaaaattaatcgaatttaatgataaatttaatgaaaataaaataaacatctta
aaagatgttgaatctttagattatgacaatccaaataaaaaaggtttactacttttaata
aaagaaagtaaaaatcaaaaagatttaaaaaatattaaagaaattatcaagcaaaaagat
gtagatcacaaattaaaaaaagaattattaaaattaactgaaaaattcaaaaaccctaat
ttaaccgaagaatgaattaagaagattacccttgcaaatgataatgaaagtcttgaaaaa
ataaagaaggatttgatatcttcaataagcaacgaggaaaatcgaatcaacgaattaaaa
gcattaaacaaaacattaattaataaaattcaggatcctggtaaaaaagatgaattttta
aaagaattaaattctgatattcatactataaattcatttcaatcattacaagaaacagta
aatcaatttctaacattagaaacttctaaaattgaagctagaaaaagagaaataatgaat
ctggtttcgaaattatcagttaataattcattaaagaaaactattagcgaatcaatatca
aaagccaatttatttaccgaattaaaagaacttgaaaaacaagttaaagattctttgaat
aaaaagaaaaatgaagttaaagaacttcttgaaaaacttggttcacctttaaaagaaaaa
tatattcaagatttaaataaactaaataccgaaatcgaatttgaagaactaaccgatgag
attaactctattttaaaaaataagaaggatgctttaactaaattaataaatgacataatt
aatgattcaaaaaatcaaaatattaaggaaaattatcttgataaattatcaaaactagaa
acaattgaccaatttaatagtttgcaatcagatttagaaaaaaatttaaatgatttaaaa
actgaggttatatcttgggctaataaactttcagatagtgatgatttaattttagaaatt
aacaaaaaagtaaactttaaagaactaaacgataaaaaacttgaaattcaggctaaatta
gataatatttataaaaatgcacaagaaaaacttaaattattagaaggagatgatctttat
aaagatttttctgataaatttaataatttaagtaatgaaagtcatgagtcagaattaaat
aattttattagcaaaattaatgaattaattgaatatcaaaaaaattctattaatgaaatg
cttaataccataaaagacaaaaacaaaaaacatgaaatatcttcttcaattaaaaatgaa
attaaacttgttgatctaaagaagcttattaaagaatcacaattacaagttaataaggaa
aaatcaattgaaaacattaaaaaaacattagtatacgctgactcacttgatgcatataaa
gaattaattaatagtgcgaaggacgaagatcaattaaaaaatattattaaagaagtaaat
aataaagaaaaccaattaaacgatctaaaacaaaataaaattccattagaagaaaaaatt
aaatccttggttaatgttgatgttgaaaaacaaaaagaattattagaaaaacttgaatta
cttagagaggataaactaagtgaaattgaaaatgagctaaatactcacattcaaaagcaa
aaagatgtagttaaagaatatcttgaagaatttttaggtaataacccacttaagcaagaa
ttagaaattaaactttcttctttaaattctgaaactgatattttaaaaattaaggaagat
cttgataataaattagctgatttaagaaaaaaaattattgataaaattgaattattaact
aatgataaacaaaaaagtcaattacttgaacaattaaatcaaaataaaactatcgagcaa
attaacgaaacattaaaacaagtcgaaattcaaagtagcaaagaaaatctattagaatta
ttaaataatgttaaaaatatagataaaaaagaagttttaaattcgaagattgaagctttt
aatgataatttaaaatataatgaacttcacaaagaaattttggatcagattgaaaaagat
ttagctgaattagaattagcatcatttaatgtaaatcaagaattaaacaaacttttaagt
gatcaagaaaataaatatgattattttaatcaattaattataaaaaattctcaatcaaaa
gaagaacttgaaaaaataacaaatgaaattaaaaaatatatttcagataagaaagaatca
attttaacaaaggttgaaaaattaaaagaagatatcccttcaacgattaataaatatcaa
gaaataaaagaagaaattataaaaaataatgatgattttaatatcagtttatacaataaa
tttaataaagaaattaatagtaactttgatttaattaaaaatttactagttacagattca
aaatttgatactatttataattctgagacctcgaaattaatatctgagttagaaagttta
acaattgaaaatagtgatgttacaaaaataatttcgcaacataagaaaatagttgattta
atttctaacaaaatattagatctttcaaaaacatttaagagtaataaagatgttcaagaa
caaaaatatagtaggttaattgaaaaaatcgtttatgaaaattatgaaaataaacaagtt
gaaaatttaatgaaaattaatgaacaattaactaatgaattaaagaaagataatgaaaaa
tttgaacaattaaaacaagaaatattaacattaaataataatttagaaagcaatgataaa
actgatttattaactaagattaatgattctacaaatacatatgaaaaattattaggattg
aaaactaatattgaagaaaaaataaatcaatataaagaagaaattaaacaaaaaattact
gcaaaacttgaaggttatgaaaatctcgataccttattaactacattggattcaaaaaat
tcatacgatgatatgaaatctgttgaagaaatcgcaaataaagcttttattgataaaaag
aatgctcttatttcaatgttagattcaagcttagaacaacaagaaaaaaattcatttaaa
aatgaattagaaaaagatgaaaatacattttcaaaattaaaagatttagaaataaaaata
gaactacaacaagctaagaataaagcaaaagaattaatcaaaaacattgaagatcctgtt
aaaaaagctgaattcgaagaaaaaataaatgctaataataatatttctgagattaataaa
ttaaataaaaatatttcttcatataataaagaacaagataataagcttgaagatttaaaa
aataaagctgttgaagttataaataaattagaaaattcaactactttaaaacaagaaatt
aaaaatgcttctaaacaagctgatgtagaaaaaataattgaagatgctaagaaaaaaata
tcagatttaaaatcagatattaataaagcgtttgaaaaattaaacggtcatgaagatttt
tcttctatttctcaagaagataaaaatttagaaaacttaaatgagacggaacttaaagaa
aaattagattcattagaacaagcatataatgaaaaaacagcaaatttaaaatcaaaattt
gaagctttgaatgctcaagataattttccaacacaattgaataattattttaataataat
gaaatttctattgagaaaaaaataattgcattaaccgcaaaagaaacatcttcattatta
aaggatattgaaaataaatctaatattttacctgattctttaaacaaagaatataaagat
ttcttattatcaaattcaattaacgaaaatgctgatttgaatgaacaaaaaaaattaaaa
tctattgtcgaatcaaaattgaaagaacttgaacaaaaaaacttagaatacaaaaatgaa
gttgatgatataaaattgagaatagatgacatattatcaagagtaaaagacccttttaaa
ttggctgaatttaatgaacaaaaacaggctattaaatttgataatagtcctgaaattaat
gatttaaataaattagagagcgacattaacaattatttaaattctttaaaaacaataaca
aatcaattgttatctaatttaaaatctgatgatcctaaattattaaatgttaaacaagtt
ttagattctgatcaacaaacagatgaaggttataaggaaattcgaaaagagttagaatta
tatattgaagaatatacaagattatcaagttcatctgttgaaaaaattaatggtcatcaa
gaatatgaaattttgaaaaataaaattttgaataataagtctcaaactgttaattctgaa
gtaaaagaaaaagccgaaagaatattcaacaataaaactgaaattgttaaaaaagaatta
aatgactttgatggtgaaaaaaataacttagaacaaaaattaactagtttaaatacatac
aaagaattggatcaacttgagaaagaaattcaagaattagcgaaaaatcaagttttagat
gaaattaataaacttcaaattgaaaatcaaaaaactaattttaaaagtgaactagcaaca
ttttctacagtctcacagttcaatgaattaaagaaaagagttaaagataaaataatttat
aatgatgcaatcgcagaagcaaaagcacaagctataactcatattaataaattatgaaat
tctaaaaaagatgaattattgaattctttcgattcattagatgatgttaatgttataaat
tctagaaaagaagatgcaattaaggcattagaaaataaaaagaaagaaattttacaaaaa
attaaaaaaatgccttttgcatcacaaagccaatttaataatgatttggaagggaaaatt
ggtgaagatttagttaagtttgaagaaaatttaaataaaatatcaactaaatttgaagaa
tttgaaaaaatattaccttcattgacttatatcaataatagaaaatcaattttagaatcc
acctgagtacacgataaggttaatacagaagaaaaaataaaatctttaagtgatgaatac
tcatcaattaatcaaaaatatagtgatcttaattcagaaatccaaaagttaccaattaat
aattcagtgagacaaaaatcagaaaatattctaaataataattcaaaattaaaaaatatt
tcagatatagaaattttgattgctgaacttaaagaagagtattcaaaactaaacaacgct
tataaagaaactaaaaaatatgcagacttattaaaaaattcttcaaatcatgctcaaaaa
gatttatttaacaacgaaaatattattcttgataaagaagaattaaatgaagtttctaaa
ataaaaactttagaacaagaatttaaaaaacaactttcaattgaaaaatttggttttatt
attgattacaataacttaaatttattagaaataaatactaacaaaaataaaaagtcaaat
ctaagacaaggtagatattatggcatagttggaacaggcagaactattttaagtgtgttg
ccagccttaaataaaaatgaaaaatacaaaatgaaagtcaataatcaatgacaggatatt
ggttttgacgaaaaagttaaagaaggaaaaaccgaaataagattagaaaaaccacttaaa
aattctgcttcatttaaagatgattatgaatttttagagttaattggaattaataaaagt
tatgattcaattagttacaatcaagtggcaggaaaaaataatttaagtattaaaaaagat
tactctattaaatttaatccttcatcgtatccattagataatttagttgatggaaataaa
aatcacgtatcacgctgggataattgaaattattgaggaaaacctcaagatgataataaa
ataacgttaacttctaatgaagaaataaaaaattatggaaaaatagatttatgagttcgt
tcaggaggtatgggatcaccaaatgaacatatgccatgaggggaatataaatgacctcat
tcatttactattagatattcaaaagacggtaaaaaatggcatgatgtagaagatcaaact
gttaaatatacagaagacttatttgttgtagatcaaaaccttaaaaataagggtatatta
tctgaaaattataatcttccacaaaaaaaatcagaaatatcagacgaggatttaaaaatt
aaaccagataatatggaatacattatatactttaatattaaatttaaaccagttgaagca
aaatatattcaagtaacatgaaaagcttcaacaagaacaattaatggaaatgataattga
actaatattattggattttcagaatttgaacttggcgaagttcaaaaagaagcaaaaaaa
gttaatattgatgatcttaataaattaaataatattaatcccgaaagtgatttaccaaaa
aatcttcgtgttttatttaaaaatacccctaataatcctgcaactcacgaaattgtagaa
tgaaaaattcaagatgaagaaataaacaaaaaattccaatttaatcatttaattttaaag
ggtaataaaacattagaaaatttagattttaaggaaataagtgttgatttaaaatcacaa
attaattattactacacaatagaagatttaggaaatataaaatttgctcaaaataatgta
aataaagaagctaaaatagtaaaaattactatttatagaaatgacttaaatcaagaagtt
agaacagtatatctaaaaattacaaaataa

DBGET integrated database retrieval system