KEGG   Moraxella catarrhalis 25239: MC25239_00110Help
Entry
MC25239_00110     CDS       T03381                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00020  Citrate cycle (TCA cycle)
mcat00190  Oxidative phosphorylation
mcat00650  Butanoate metabolism
mcat01100  Metabolic pathways
mcat01110  Biosynthesis of secondary metabolites
mcat01120  Microbial metabolism in diverse environments
mcat01130  Biosynthesis of antibiotics
mcat01200  Carbon metabolism
Module
mcat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcat_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC25239_00110 (sdhA)
   00650 Butanoate metabolism
    MC25239_00110 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC25239_00110 (sdhA)
Enzymes [BR:mcat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MC25239_00110 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     MC25239_00110 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 Thi4 GIDA Pyr_redox_3 FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AIT42572
UniProt: A0A3A9PBV1
LinkDB All DBs
Position
127851..129701
Genome map
AA seq 616 aa AA seqDB search
MATNQDNTINNIPTLNFDAVIVGGGGSGMRASLQLVNGGMKVAVITKVFPTRSHTVAAQG
GIGASLGNMSPDNWHFHFYDTVKGSDWLGDQDAIEYMCREAPKVVYELEHMGMPFDRNAD
GTIYQRPFGGHSSNYGEKPVPRACAAADRTGHALLHTLYQKNLEKGTQFFVEWIALDLIK
DDEGNINGVIALDQETGNISVFQANTTVLATGGAGRIFKASTNAYINTGDGLGMAVRAGI
PLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKHGEAFMERYAPTLKDLAPRDFVSR
SMDQEIKEGRGCGPNGDYIVMDMTHLGAATLMKRLPSVFEISKNFGNVDITKEPVPVVPT
IHYMMGGIPTNIHGQVTVPNLEGPVDEQGLYTEGRIVKGLYAIGECACVSVHGANRLGTN
SLLDLVVFGRAAGQHIIDEFNQTGRNYKPLNPRVLDFTQSRLDKLQNSTEGYNAQEVADE
IRNTMQSHAGVFRTQALMDEGVQKIMALAPKVEQIHLADKSAVFNTARIEALEVANLYEV
AKATMISASLRHECRGAHMVVDYEHPADYEPAPLGRNDSEWMKHTIWYSEGNKVVYKPVR
KQPLTVDYCVPRVRTF
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaaaccaagataacacaattaataatatcccaacgctaaactttgatgccgtc
atcgttggcggtggtggttcaggcatgcgtgcgtcattgcaattagtcaatggtggtatg
aaagtcgctgtcattaccaaagttttccccactcgctcacataccgttgcagcccaaggt
ggtatcggtgcatctttgggtaatatgagtcctgataactggcattttcatttttatgat
accgtcaaaggctctgactggttaggtgaccaagacgccattgaatatatgtgccgtgaa
gcacctaaggtcgtttatgagctagaacacatgggcatgccctttgaccgtaacgcagat
ggtacgatttaccagcgcccatttggtggtcacagctcaaattatggcgaaaaacctgtg
cctcgtgcgtgtgctgccgccgaccgtacaggtcatgcgcttttgcataccttataccaa
aaaaatcttgaaaaaggcacacagttttttgtggagtggattgcgctcgacttgattaaa
gatgatgaaggtaatattaatggcgtgatcgccctagaccaagaaacaggtaatatttcg
gttttccaagccaataccacagtattagcaacaggtggtgcaggtcgtatctttaaagca
tcaaccaatgcttatattaatacaggagatggcttgggcatggcggtgcgtgctggcatt
cctttgcaggacatggaattttggcaatttcacccaacaggtgtggcaggagctggcgtc
ctattgaccgaaggctgtcgtggtgagggtgcaattttacgcaataagcatggcgaagca
ttcatggagcgttatgccccaactctaaaagatttggcccctcgtgatttcgtctctcgc
tctatggaccaagagattaaagagggtcgtggttgtggtcccaatggtgattacattgtc
atggacatgacgcacttaggtgctgctacgctgatgaagcgcttgccgtcagtgtttgag
attagcaaaaactttggtaatgtggatattaccaaagaacctgtgcctgttgtgccgact
atccattatatgatgggtggtattccaaccaacattcacggtcaggttactgtaccaaac
ctagaaggtcctgttgatgaacagggtctatataccgaaggtcgcattgttaaaggtctt
tatgccattggtgagtgtgcgtgtgtatctgttcatggtgccaaccgcttaggtactaac
tcactgcttgatttggtggtgtttggtcgtgcagcaggtcagcacatcattgatgaattt
aaccaaacggggcgtaattataagccgcttaatccacgggtgctagattttacccagtct
cgtcttgataagctacaaaactctaccgaaggctacaatgcccaagaggttgctgatgag
attcgtaataccatgcagtctcatgctggcgtgtttcgtactcaggcactgatggatgaa
ggtgtacaaaaaatcatggcacttgccccaaaagttgagcaaatccatttggcagataaa
tcagctgtctttaataccgcccgtattgaggcacttgaggtagcaaacttatatgaagtt
gcaaaagcaactatgatttctgcgtctctgcgtcacgaatgtcgtggtgcacatatggtg
gttgattatgagcatccagcagattatgagccagcaccacttggccgtaatgatagcgaa
tggatgaagcacacaatttggtattcagagggtaataaagttgtgtataagccagttcgt
aagcagccattgacggttgattattgtgtgccgcgtgttcggactttctaa

DBGET integrated database retrieval system