KEGG   Moraxella catarrhalis 25239: MC25239_00111Help
Entry
MC25239_00111     CDS       T03381                                 

Gene name
sdhB
Definition
(GenBank) Succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00020  Citrate cycle (TCA cycle)
mcat00190  Oxidative phosphorylation
mcat00650  Butanoate metabolism
mcat01100  Metabolic pathways
mcat01110  Biosynthesis of secondary metabolites
mcat01120  Microbial metabolism in diverse environments
mcat01130  Biosynthesis of antibiotics
mcat01200  Carbon metabolism
Module
mcat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcat_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC25239_00111 (sdhB)
   00650 Butanoate metabolism
    MC25239_00111 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MC25239_00111 (sdhB)
Enzymes [BR:mcat01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MC25239_00111 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     MC25239_00111 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer4_7 Fer4_9 Fer4_16 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: AIT42573
UniProt: A0A198WT57
LinkDB All DBs
Position
129772..130482
Genome map
AA seq 236 aa AA seqDB search
MSRGTRIVEIYRYDPDKDNAPYMQSYTVELLDSDRMLLDVLLRLKREDETLTFRRSCREG
ICGSDGMNINGKNGLACLINMNTLPNKITIRPLPGLPVIKDLVVDMNQFYEQYEKVHPYL
INNQPAPPKERLQSPEEREKMNGLYECILCACCSTACPSFWWNPDKFLGPSALLNGYRFI
IDSRDTDTQARLARLDDPFSLFRCRGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaggcacccgtatcgtagagatttatcgctatgacccagacaaagataatgcc
ccttatatgcagtcatataccgttgaattactagattcagaccgtatgttgcttgatgtt
ttacttcgcctaaagcgtgaagatgaaaccttaactttccgccgctcgtgccgtgagggt
atttgtggctctgatggtatgaatatcaatggcaaaaatggtttggcatgcttgattaat
atgaatactttgccaaacaaaatcaccatccgacctttaccagggttgcctgtgattaaa
gatttggttgtggatatgaaccaattttatgaacagtatgaaaaagttcatccatattta
attaataaccagcctgcaccgcctaaagagcgattgcaatcaccagaagagcgtgaaaaa
atgaacggtctttacgagtgtatcttgtgtgcgtgctgttcaacggcttgcccatcattt
tggtggaatcctgataaattcttaggcccatctgcattattaaatggctatcgttttatt
attgatagtcgtgataccgacacccaagctcgtttggctcgcttagatgacccatttagc
ttattccgttgccgtggtattatgaactgtgtcagcgtttgccccaaggggttaaaccca
accaaagccatcggtcatattcgtaatatgcttttagatcaagcaggataa

DBGET integrated database retrieval system