KEGG   Moraxella catarrhalis 25239: MC25239_00129Help
Entry
MC25239_00129     CDS       T03381                                 

Gene name
fadB
Definition
(GenBank) Fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00071  Fatty acid degradation
mcat00280  Valine, leucine and isoleucine degradation
mcat00281  Geraniol degradation
mcat00310  Lysine degradation
mcat00362  Benzoate degradation
mcat00380  Tryptophan metabolism
mcat00410  beta-Alanine metabolism
mcat00640  Propanoate metabolism
mcat00650  Butanoate metabolism
mcat00903  Limonene and pinene degradation
mcat00930  Caprolactam degradation
mcat01100  Metabolic pathways
mcat01110  Biosynthesis of secondary metabolites
mcat01120  Microbial metabolism in diverse environments
mcat01130  Biosynthesis of antibiotics
mcat01200  Carbon metabolism
mcat01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MC25239_00129 (fadB)
   00650 Butanoate metabolism
    MC25239_00129 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MC25239_00129 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MC25239_00129 (fadB)
   00310 Lysine degradation
    MC25239_00129 (fadB)
   00380 Tryptophan metabolism
    MC25239_00129 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MC25239_00129 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MC25239_00129 (fadB)
   00281 Geraniol degradation
    MC25239_00129 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MC25239_00129 (fadB)
   00930 Caprolactam degradation
    MC25239_00129 (fadB)
Enzymes [BR:mcat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MC25239_00129 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MC25239_00129 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MC25239_00129 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     MC25239_00129 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AIT42591
LinkDB All DBs
Position
156347..158500
Genome map
AA seq 717 aa AA seqDB search
MIYQGKNIQVDFFDQTQGIVQFHFNATDESVNKFDRKTTQEYQEAVTVLENRDDIQGLIV
TSGKSVFIAGADITEFTEYFSRSKDEIEAWLLDINHIFNRFEDLPFPKVAAINGAALGGG
CEMALVCDYRVAGISAQIGLPETKLGIFPGFGGSVRLPRLIGIDNALEAIATGKAYRPDE
ALKLGLVDAVVADELLEQAAADLVKKCLLGKFDWQAKRQEKQVPVKLNQLEQAMAFNSAK
GVIFAKANPKHYPAVAIALETIEKHANLNRDDAIALEAKGFTKAATTPQAAALVGLFLND
QTVKKLAKKHSQNAQTIKQAAVLGAGIMGGGIAYQAAVKGLPIIMKDIQAKQLDLGMNEA
GKLLSKEVLRGKSTPAKMAQTLSHIRPTLNYGDFGEVDIVIEAVVENPTIKEAVLSEVEG
LVKQETILASNTSTISITRLANALKRPENFVGMHFFNPVHRMPLVEVIRGEKTSDIAIAT
TVALAQKMGKTPIVVNDCPGFLVNRVLFPYFGAFDLLVKEGADFVSIDKTMEKFGWPMGP
AYLLDVVGMDTGVHAAKVMAEGFPDRMKPDYKGATQLMFEHERLGQKNGVGFYQYETDKR
GKPKKIADSTTYELLNLVQTGDQTFDEQEIIDRMMIAFCNETVRCLEDDIVASPAEADMA
MIMGVGFPPFRGGPCRYIDQIGVANYVALCDKYAHLGKAYEAPAKLRDMAQNGETFY
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgatttatcaaggaaaaaatattcaggtcgatttttttgaccaaacacaaggtatcgtg
cagtttcattttaatgccactgatgaaagcgttaataaatttgatcgcaaaaccactcaa
gaatatcaagaagcggtaacagtacttgaaaaccgtgatgatattcaaggcttaattgtc
acttcaggtaaatcggtgtttattgctggtgcggatattactgagtttaccgaatatttt
agtcgctctaaagatgaaattgaggcatggcttttggatatcaatcatatttttaatcgc
tttgaggatttgcccttcccaaaagtggcggcgattaatggtgcagcgttaggcggtggc
tgtgagatggctttggtatgcgattaccgtgtggcgggtatttctgcccaaattggtttg
cctgaaactaagcttggtatttttccaggttttggtggttcagtgcgtctgccacgcctg
attggcattgataacgcccttgaggccattgcgacaggtaaggcttatcgacctgatgaa
gcacttaaattgggattggttgatgcggtggtggctgatgagctgcttgagcaggcagcg
gctgatttggtcaaaaaatgcttattaggcaagtttgattggcaggcgaagcgtcaagaa
aaacaagtaccagttaagctcaatcagctggagcaggcaatggcatttaattcggctaag
ggtgtcatttttgccaaagccaatccaaaacattatcctgcggtggcgattgcccttgag
accatcgaaaaacacgccaatttaaaccgtgatgatgcgattgcccttgaagccaaaggt
tttacaaaagctgcaacaaccccacaagcggccgccttggtcggcttatttttaaatgac
caaacagttaaaaaacttgccaaaaagcacagtcaaaatgcacaaaccatcaagcaagca
gctgtacttggtgcaggtatcatgggtggcggtatcgcttatcaggcagcggtcaagggc
ttgccaattattatgaaagacattcaagccaagcagttagaccttggcatgaatgaagct
ggtaaactgttatcaaaagaggttttgcgtggtaaatcaacgccagctaagatggctcaa
accttaagccacattcgcccaaccttaaactatggcgattttggtgaagttgatattgtg
attgaggcggtcgttgaaaaccctacaatcaaagaagcggtattgtctgaggtggagggc
ttggtaaaacaagagaccattttggcctcaaatacctcaacgatttctatcactcgcttg
gcgaatgccctaaaacgccccgaaaactttgtgggtatgcacttttttaacccagtacat
cgcatgccgttagttgaggtgattcgtggcgagaagaccagcgatatcgccattgcaaca
acggttgcattggcacaaaaaatgggcaaaactccaattgtcgtcaatgactgcccagga
tttttggtgaatcgtgtgttatttccttattttggtgcgttcgatttgctggtcaaagaa
ggtgccgattttgttagtattgataagaccatggaaaaatttggctggccgatgggtcct
gcgtatcttttggatgttgtgggtatggatacaggcgtgcatgctgccaaggtgatggca
gagggtttccctgatcgtatgaagccagattataaaggtgcaacgcagctgatgtttgag
catgagcgtttgggtcaaaaaaatggtgttggtttttatcaatatgaaactgataagcgt
ggcaaacctaaaaaaattgccgatagtaccacttatgagctgttaaacttggttcaaact
ggcgatcagacttttgatgagcaagaaattatcgaccgcatgatgattgcattttgcaat
gaaaccgtacgctgcttggaagatgatatcgtagcaagccctgctgaagctgatatggcg
atgattatgggcgtaggtttcccaccatttcgtggcggcccttgccgatatatcgaccaa
atcggtgtcgcaaactatgttgcattgtgcgataagtacgcacatttaggtaaggcatat
gaagcacctgccaaattgcgtgatatggctcaaaatggcgagactttttactaa

DBGET integrated database retrieval system