KEGG   Moraxella catarrhalis 25239: MC25239_01346Help
Entry
MC25239_01346     CDS       T03381                                 

Gene name
fadD_1
Definition
(GenBank) Long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00061  Fatty acid biosynthesis
mcat00071  Fatty acid degradation
mcat01100  Metabolic pathways
mcat01212  Fatty acid metabolism
mcat02024  Quorum sensing
Module
mcat_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    MC25239_01346 (fadD_1)
   00071 Fatty acid degradation
    MC25239_01346 (fadD_1)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MC25239_01346 (fadD_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mcat01004]
    MC25239_01346 (fadD_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcat04147]
    MC25239_01346 (fadD_1)
Enzymes [BR:mcat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     MC25239_01346 (fadD_1)
Lipid biosynthesis proteins [BR:mcat01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   MC25239_01346 (fadD_1)
Exosome [BR:mcat04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   MC25239_01346 (fadD_1)
  Exosomal proteins of breast cancer cells
   MC25239_01346 (fadD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AIT43750
LinkDB All DBs
Position
complement(1464632..1466344)
Genome map
AA seq 570 aa AA seqDB search
MNMSNMTDFTVSTDAPWYKTYQEHGLDFNFDLPDNINSLMDIFDQAFARFGNQVAFTCMD
KSITYRQLDNYSRQMAAYLQSLGLVKGDKVAVMMPNILQYPIAMIAIVRAGLTLVNVNPL
YTSNELEHQLNDSEAKALFIVENFAHTFEKVVNKGQVRHVIVASLGDMLGLKGFLVNAVV
RHVKKMVPEWNIPGHVSFKDALNKVPIGNYNRPNLALDDIAVLQYTGGTTGVAKGAMLTH
RNLASNVEQCAPFLSLVFSKDNLSGQYIAVALPLYHIFSFTACGLLGMKMGFSMLLITNP
RDFPALCKDYAKYKPAFFPAVNTLFNGLVHHEGFRSLDHSNLKLSLGGGMSVLSDTAKAW
ERLTGNYIIEGYGLSETSPVLTLNPPGGYTGKIGIPIPATDIKILDDEGNELAMGEAGEI
CAKGPQIMVGYWNRLDETEKVMTKDGFFRTGDIGVMDDRGFIKIVDRKKDMILVSGFNVY
PNEVEDIITAHPKVIECGVIGVPDDHSGEVVKVFVVKKDPSLTADEVRAWAKENLTGYKR
PKYIEFISELPKSNVGKILRKELRVLEQSK
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgagtaacatgactgattttaccgtttcaacggatgcaccttggtataaaacc
tatcaagaacatggtcttgattttaactttgatttgcctgacaatatcaattcactcatg
gatatttttgatcaggcatttgcacgcttcggtaatcaagttgcgtttacttgcatggat
aaatctatcacctatcgacaactggataactatagtcgtcaaatggcggcatatttacaa
tcgctaggcttggtcaaaggtgataaagtagcggtcatgatgccaaatattttgcaatat
ccgattgcgatgattgcgattgtgcgtgctggattgacattggtgaatgtcaaccctttg
tatacctcgaatgagcttgaacatcagctcaatgactcagaagctaaagcgttatttatt
gtagaaaattttgctcatacttttgaaaaagtggttaataaaggtcaagttcgccatgta
attgttgcatctttgggcgatatgcttggcttaaaaggctttttggtcaatgcagtggtg
cgtcatgttaaaaaaatggtgcctgaatggaatatccctggtcatgtatcatttaaagac
gcactcaacaaagtgccgataggtaactacaatcgccctaatttggctttggatgatatt
gctgtattgcagtatacaggcggtacaacaggcgtggcaaaaggtgcgatgctcacccat
cgtaatcttgcttcaaatgttgagcagtgtgcgccatttcttagcttggtattttctaaa
gacaatctatctggtcagtatatcgcagttgccttaccgctttaccatattttttcattc
acagcgtgtggtttgttggggatgaagatgggttttagtatgttattaattaccaaccca
agagattttccagcactgtgtaaagattatgccaaatataagcctgcattttttcctgca
gtgaatactttatttaatggtttggtgcatcatgaaggatttcggtcacttgaccatagt
aatttaaaattatcattaggcggtggcatgtcagttttatccgatactgccaaagcatgg
gagcgtttgacgggtaattatatcatcgaaggctatggtttatctgaaacctcgcctgtt
ttgaccctaaatccaccaggtggatacacaggtaagattggtattccaattcctgccacc
gacattaaaattttggatgatgagggcaacgagttggcgatgggtgaggctggtgaaatt
tgtgccaaaggtccacaaatcatggtcggctactggaatcgccttgatgaaaccgaaaag
gttatgaccaaagatgggttttttcgtacaggcgatattggcgtgatggatgatcgtggc
tttattaaaattgttgatcgcaaaaaagatatgattttggtgtctggatttaatgtctat
cccaatgaggttgaagatatcattactgcccatccaaaagtcattgaatgtggcgtgatt
ggtgtgcctgatgatcacagtggtgaagtggttaaggtctttgtggtcaaaaaagatccc
tccttgaccgccgacgaggtgcgtgcttgggcaaaagaaaacctaacaggttacaaacgc
cccaaatatattgagtttatcagtgagcttcccaaatctaatgttggtaaaattttgcgt
aaggaattaagagtacttgagcaaagcaaataa

DBGET integrated database retrieval system