KEGG   Moraxella catarrhalis 25239: MC25239_01399Help
Entry
MC25239_01399     CDS       T03381                                 

Gene name
mdh
Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
mcat  Moraxella catarrhalis 25239
Pathway
mcat00020  Citrate cycle (TCA cycle)
mcat00270  Cysteine and methionine metabolism
mcat00620  Pyruvate metabolism
mcat00630  Glyoxylate and dicarboxylate metabolism
mcat00680  Methane metabolism
mcat01100  Metabolic pathways
mcat01110  Biosynthesis of secondary metabolites
mcat01120  Microbial metabolism in diverse environments
mcat01130  Biosynthesis of antibiotics
mcat01200  Carbon metabolism
Module
mcat_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcat_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mcat_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mcat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MC25239_01399 (mdh)
   00620 Pyruvate metabolism
    MC25239_01399 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    MC25239_01399 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    MC25239_01399 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MC25239_01399 (mdh)
Enzymes [BR:mcat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     MC25239_01399 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AIT43795
LinkDB All DBs
Position
1518765..1519751
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEIPVEKAQQALQGVIMELD
DCAFPLLVDVIGTDDPKVAFKDADYALLVGARPRGPGMERADLLQENAKIFTVQGKALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALTQVAKKTGKAVKDI
KKLIVWGNHSPTMYADYRFATINGESVKEIINDQDWNANTFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGSNGEWVTMGIPSDGSYGIPKGIMFGFPVTTENGEYQIVQDLQ
IDDFSQERINITLNELEEERAAIDHLFS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacctgtacgagttgctgtcactggtgctgctggtcaaattggctacagctta
ctattccgtatcgcatcaggtgaaatgctgggtaaggatcagcctgtcattttacaatta
cttgaaattcctgttgaaaaagcacaacaagcactacaaggcgttatcatggaacttgat
gactgtgcttttccattattagttgatgtcattggtaccgatgatcctaaagtagcattt
aaagatgctgattatgcactattggttggtgctcgcccacgcggtcctggcatggagcgt
gctgacctgcttcaagaaaatgcaaaaatctttactgttcaaggtaaggcgcttaatgaa
gttgcaagtcgtgatgttaaagtattagtcgttggtaacccagcaaataccaatgcttat
atcgccatgaaatcagcacccgatttaccagccaaaaatttcaccgccatgctgcgtctt
gaccataaccgtgcgttaacgcaagttgccaaaaaaacaggcaaagctgtcaaagacatc
aaaaaattaatcgtttggggcaaccacagtccaaccatgtacgctgattatcgctttgct
accattaatggcgaatcagtcaaagagataatcaatgatcaagactggaatgctaataca
ttcctgccaaccgttggtaagcgtggtgcagcgattatcgaagcgcgtggcttatcatca
gctgcttctgctgccaatgcagccatcgatcatatgcgtgattgggcattaggctcaaat
ggtgaatgggtaactatgggtattccatctgatggctcgtatggcattcctaaaggtatc
atgttcggcttccctgtgactaccgaaaatggtgaatatcaaatcgtccaagatttgcaa
attgatgacttcagccaagagcgtatcaatatcacactaaacgaacttgaagaagagcgt
gccgctattgatcatttattttcttaa

DBGET integrated database retrieval system