KEGG   Mycolicibacterium chubuense: Mycch_0148Help
Entry
Mycch_0148        CDS       T02150                                 

Definition
(GenBank) ATP-grasp enzyme, D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00473  D-Alanine metabolism
mcb00550  Peptidoglycan biosynthesis
mcb01100  Metabolic pathways
mcb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mycch_0148
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mycch_0148
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Mycch_0148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mcb01011]
    Mycch_0148
Enzymes [BR:mcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mycch_0148
Peptidoglycan biosynthesis and degradation proteins [BR:mcb01011]
 Precursor biosynthesis
  Amino acid ligase
   Mycch_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C CPSase_L_D2 RimK ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AFM14974
UniProt: I4BCG7
LinkDB All DBs
Position
complement(137627..138673)
Genome map
AA seq 348 aa AA seqDB search
MAIRLGHRVVQLAGSPVDEFHAELSRLYARDSAAVLAEHHAVQFAYVEPGGSWRFPARLD
AASLAAARSVPAPAAIAHLMALRPDVVVPQMFCRPGMTAYRALLDVLGLPYVGNTAQVMA
NTADKAVARALVAAYGVAVPAGQLVTNASDVRLELPVVVKPARSDNSLGVSLVQDASTLA
VAVAHAAELDAGVLVETYIPLGREVRCGVLEVDGELVCLPLEEYALDAQRAPIRLADDKL
GRTAGGDLRLVATDAGRAWILAGDDAADDTVVDAVFDAARTCFRALGCRHYGLFDFRIDP
QGRPWFLEAGPYCSFAPSSVVAKMAEAAGLSLPALFDTVCRQARIGAS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggcgattaggttgggacacagggttgttcagttggccggttctccggtcgacgaattc
cacgccgagctgtcgcggctgtacgcccgggacagcgccgcggtgctggccgagcaccac
gcggtgcagttcgcctatgtcgagccgggtggctcgtggcggttccccgcccggctcgat
gcggcgagcctggcagctgcgcggtcggtaccggcgcctgcggccatcgcacatctcatg
gcgctgaggccggacgtggtggtgccgcagatgttctgccgtcccggcatgacggcctat
cgtgcgctgctcgacgtactcggcctgccctacgtcggcaacaccgcgcaggtgatggcc
aacaccgccgacaaggccgtggcccgcgcgctggtggcggcttacggagtcgcggtaccg
gccggccagctggtcaccaatgcctccgacgtgcggttggagctgccggtcgtcgtcaag
ccggccagatccgacaactccctgggcgtgtcactggtgcaggacgcgagcactctggca
gtcgcggtggcacacgcggcggaactggacgcgggcgtcctcgtcgagacctacatcccg
ctggggcgcgaagtacgatgcggcgtcctggaagtcgacggcgagctggtctgtctgccg
ctggaggagtacgccctcgacgcgcagcgcgcaccgatccggctggccgacgacaaactc
ggccgcaccgccggcggagacctgcgcctcgtcgccacggacgccgggcgggcgtggatc
ctcgccggcgacgatgctgccgacgatacggtcgtcgacgcggtcttcgacgcggcacgg
acctgtttccgggccctcgggtgccggcactacggtctgttcgacttccggatagacccg
cagggcaggccgtggttcctcgaggccgggccctactgctcgttcgccccgtcgagtgtg
gtcgccaaaatggccgaggcagcgggtttgtcgttgccggcgttgttcgacaccgtgtgc
cgccaagcgcgaatcggggcgtcgtga

DBGET integrated database retrieval system