KEGG   Mycolicibacterium chubuense: Mycch_1086Help
Entry
Mycch_1086        CDS       T02150                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mcb  Mycolicibacterium chubuense
Pathway
mcb00473  D-Alanine metabolism
mcb01100  Metabolic pathways
mcb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mycch_1086
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Mycch_1086
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mcb01011]
    Mycch_1086
Enzymes [BR:mcb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Mycch_1086
Peptidoglycan biosynthesis and degradation proteins [BR:mcb01011]
 Precursor biosynthesis
  Racemase
   Mycch_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AFM15895
UniProt: I4BF38
LinkDB All DBs
Position
1088405..1089529
Genome map
AA seq 374 aa AA seqDB search
MNTPTAVVDLDAIAHNVVTLREHAGSAAVMAVVKADGYGHGAAAVARAALAAGAAELGVA
TVDEALAVRRDGVTAPVLAWLHPPGTDFAPALLADVEVAVSSCAQVGDVLDAAARTGRTA
TVTVKADTGLSRNGVSPADYPAVLAALQRAVADEAVRVRGLMSHLAHGDEPGHPFNDEQA
RRLTEMAALARSRGLTYDVVHLSNSPAALTRPDLAFDMVRPGIAVYGLSPIPERGDMGLR
PAMTVQCPVVMVRSIRAGDGVSYGHTWSAPRDTTVALIPAGYADGVFRPLSNRMEVMING
RRYPNVGRICMDQFVVDLGPGPVDVVEGDEAILFGPGTAGEPTAQDWADLLGTINYEVVT
SPRGRIVRTYRGSV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcctaccgcggtcgtcgacctcgacgccatcgcgcacaacgtcgtcacgctg
cgcgaacacgccggctcggcggcggtgatggctgtcgtgaaggccgacggctacggccac
ggggcggcggcggtggctcgcgccgcgctggccgccggtgcggcggaactgggcgtcgcc
acggtcgacgaggccctcgcggtgcgccgcgacggcgtcaccgcgcccgtgctggcgtgg
ctgcatccgcccggcacggacttcgcgcccgccctgctcgccgacgtcgaggtcgccgtg
tcgtcgtgcgcgcaggtcggcgatgtcctcgacgccgccgcacggaccggccgcaccgcg
accgtgaccgtcaaggccgacaccgggctctcccgcaacggtgtcagcccggcggactac
ccggcggtcctcgcggccctgcagcgcgcggtggccgacgaggcggtgcgggtgcgcggc
ctgatgtcccacctggcgcacggcgacgaacccggccatcccttcaacgacgagcaggcc
cggcggctgaccgagatggcggccctggcgcgctcgcgggggctgacttacgacgttgtg
cacctgagcaattcgcccgcagcgctgacgcgtcccgatctggcgttcgacatggtgcgg
ccgggcatcgcggtgtacggcctgagccctataccggagcgcggagacatgggactgcgg
ccggcgatgacggtgcaatgcccggtcgtgatggtgcgatcgatccgcgccggggacggg
gtgtcctacgggcatacctggtccgcgccgcgcgacaccacggtggcgctgatcccggcc
gggtatgccgacggcgtcttccgcccgctgagcaaccggatggaggtcatgatcaacggc
cgccgctacccgaacgtcggacggatctgcatggaccagttcgtcgtggatctggggccg
ggacccgtcgacgtcgtcgagggcgacgaggcgatcctgttcggacccggcaccgcgggc
gagccgacggcccaggactgggcggatctgctgggcacgatcaactacgaggtcgtgacg
agcccgcgcggacggatcgtgaggacctaccgggggtcggtgtga

DBGET integrated database retrieval system