KEGG   Mycolicibacterium chubuense: Mycch_3627Help
Entry
Mycch_3627        CDS       T02150                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
Organism
mcb  Mycolicibacterium chubuense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFM18360
UniProt: I4BM53
LinkDB All DBs
Position
3824284..3825729
Genome map
AA seq 481 aa AA seqDB search
MPYDKLFIGGVWRAPSTGNRIEVVSPHSEAPVARVAAAGPADVTAAVEAARTAFDSGPWP
RTDPADRVEALRRLAALYGERRADMAELITAEIGAPISFAHRAQVALPWMVMKAFCDLAE
TYPWREARPGLYGSDIHIRREPVGVVTAIVPWNMPQFLIVTKLIPALLAGCTVVLKPAPE
APLDALLLAELIDEAGLPPGVVNILPGDGAAGQALVSHPGVDKVSFTGSTAAGKAVAAAC
AGDLRKVSLELGGKSAAIVLDDADAASVAAGVRSASLSNSGQICNALTRILVPESRASEF
TQALAAEMDSLVVGNPADTATQVGPLVAQRQQKRVLDYIERGVADGARIVTGGTGMPAGL
DRGWYVKPTLFDNADNAMAIAREEIFGPVLTVISYSDTADAIRIANDSDYGLAGSVWTAD
DERGLAVAGEIRTGTFGVNQGYTMDPFAPFGGVKASGYGRELGREGLDGYIETKSIAVAA
R
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgccctacgacaagctgttcatcggtggtgtctggcgggcaccgagcaccggcaatcga
atcgaggtggtctctccacactccgaggcgccggtcgcccgggtggccgcggccggcccc
gccgacgtgacggcggccgtcgaggcggcgcgaacggcgttcgactccggaccgtggccg
cggacggatcccgccgatcgcgtcgaggctctgcgccggctcgccgctctctacggtgag
cggcgcgccgacatggccgagctcatcaccgcggagatcggcgcgccgatcagcttcgct
catcgggcccaggtggcgctgccgtggatggtgatgaaggccttctgcgacctcgcggag
acctacccgtggcgcgaggcgaggccgggcctgtacggctcggacattcacatccgccgc
gagccggtgggagtggtgaccgccatcgtgccgtggaacatgccgcaattcctcatcgtc
accaagttgatcccggcgctgctcgccgggtgcaccgtcgtcctcaaacccgcaccggaa
gcaccgctcgacgcgctgctgctcgccgaactgatcgacgaggccgggctaccgccgggc
gtcgtcaacatcctgcccggcgatggtgcggccgggcaggcactggtcagccatcccggc
gtggacaaggtctcgttcaccgggtcgacggccgccggcaaggccgtcgccgcagcgtgc
gccggcgacctccgcaaggtgagcctggaactcggcggcaagtcggccgcgatcgtgctc
gacgacgccgacgcggcgtccgtcgccgcgggagtgcggtcggccagcctgtccaacagc
ggccagatctgcaatgccttgacgcgcatcctggtgcccgaatcgcgcgcatcggagttc
acgcaggcactggccgcggagatggattcgctcgtcgtcgggaatccggccgacaccgcg
acccaggtcggaccccttgtcgcgcaacgacagcagaagcgcgtcctggactacatcgaa
cgcggagtggccgacggcgcgcgcatcgtgacgggcggcaccgggatgccggcggggctg
gaccgcggctggtacgtcaagccgacgctgttcgacaacgcagacaatgccatggcgatc
gcccgtgaggagatcttcggcccggtcctcacggtcatctcctactccgacaccgccgat
gcgatccgcatcgccaacgactccgactacggtctggccggctcggtgtggactgccgac
gacgagcgcggcctggccgtggcaggcgagatccgcaccggcacgttcggcgtcaaccag
ggctacaccatggatccgttcgcgccgttcggtggcgtcaaagccagcggctacggacgc
gagctgggccgggaaggcctcgacggctacatcgagaccaaatccattgcagtggcggcg
cgctag

DBGET integrated database retrieval system