KEGG   Mycolicibacterium chubuense: Mycch_4876Help
Entry
Mycch_4876        CDS       T02150                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mcb  Mycolicibacterium chubuense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFM19569
UniProt: I4BQL2
LinkDB All DBs
Position
complement(5118483..5119592)
Genome map
AA seq 369 aa AA seqDB search
MGIVQLPVMPPLEPMLAKAQTTVPTDAGVWSYEPKWDGFRALVFRDGDDVVLLSRSGKDL
ARYFPEVLDAVRDELAPRCVLDGEIVVPREITADARSNENTADARSKTAKSRVRLDWESL
SQRIHPAESRVRLLSTQTPAHFIGFDALAVGDTSLLRAPFRTRREALSGAVDEKQWCHVT
RTTEDPVLGAQWLQEFEGAGLDGVIAKRLDGPYLAGKREMVKVKHHRDADCVAMGYRIHK
SGEGIGSILLGLYRADGELQMVGGAASFTAKARLKLLADLEPLRIGDEVRDGEPSRWNSA
ADKRWIPVRPERVCEVAYDQMEGNGEYGQRFRHAVKFLRWRPDRDPASCTFEQLDVPLNY
DLYDVLERS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcgtgcagcttcctgtgatgcccccactcgaaccgatgctggccaaggcgcag
accacggtgccgaccgatgccggggtgtggtcgtacgagccgaagtgggacggcttccgg
gcgctggtgttccgcgacggcgacgacgtcgtgctgctgtcgcgcagcggcaaggatctg
gcgcgctacttccccgaggtcctcgacgcggtgcgcgacgaactcgcgccgcgttgcgtg
ctggacggcgagatcgtcgtgccccgcgagatcactgcggacgcgaggagcaatgagaac
actgcggacgcgaggagcaagacggccaagagccgggttcggctggactgggagtcgctg
agccagcgcatccatcccgccgagtcgcgggtccggctgctctcgacgcagaccccggcg
cacttcatcggtttcgacgcgctggccgtcggcgacacgtcgttgcttcgcgcaccgttc
cgcacgcgtcgagaggcgctgtccggggcggtcgacgagaagcagtggtgccacgtcacc
cggaccaccgaggatcctgttctgggtgcgcagtggctccaggagttcgagggcgccgga
ctcgacggcgtgatcgccaagcgcctcgacgggccctaccttgcgggcaagcgcgagatg
gtgaaggtcaagcatcaccgcgacgcggactgtgtggcgatgggctatcggatccacaag
agtggtgaaggcatcggatcgatccttctgggcctataccgcgccgacggcgagctccag
atggtcggtggcgctgcgtcgttcacggccaaggcgcgactgaagctgctcgccgacctg
gagccgctgcgcatcggcgacgaggtgcgcgacggcgaacccagccgctggaactccgcg
gcggacaagcgctggatcccggtgcgcccggagcgggtgtgcgaggtcgcctatgaccag
atggagggaaacggcgagtacgggcagcgattccggcacgccgtgaagttcctgcgctgg
cggcccgaccgtgatccggccagctgcacgttcgagcagctcgacgtgccgttgaactac
gatctctacgacgtcttggagcgatcctga

DBGET integrated database retrieval system