KEGG   Macaca mulatta (rhesus monkey): 100135775
Entry
100135775         CDS       T01028                                 

Gene name
PDCD1
Definition
(RefSeq) programmed cell death protein 1
  KO
K06744  programmed cell death protein 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04514  Cell adhesion molecules
mcc04660  T cell receptor signaling pathway
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100135775 (PDCD1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100135775 (PDCD1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100135775 (PDCD1)
CD molecules [BR:mcc04090]
 Proteins
  100135775 (PDCD1)
SSDB
Motif
Pfam: V-set Ig_3 ig I-set Ig_2 RskA
Other DBs
NCBI-GeneID: 100135775
NCBI-ProteinID: NP_001107830
Ensembl: ENSMMUG00000008592
UniProt: B0LAJ2 G7N9F1
LinkDB
Position
12
AA seq 288 aa
MQIPQAPWPVVWAVLQLGWRPGWFLESPDRPWNPPTFSPALLLVTEGDNATFTCSFSNAS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGRDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQALVVGVVGGLLGS
LVLLVWVLAVICSRAAQGTIEARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPAP
CVPEQTEYATIVFPSGLGTSSPARRGSADGPRSPRPLRPEDGHCSWPL
NT seq 867 nt   +upstreamnt  +downstreamnt
atgcagatcccacaggcaccctggccggtcgtctgggcggtgctacaactgggctggcgg
ccaggatggttcttagaatccccggacaggccctggaacccccccaccttctccccagcc
ctgctcctggtgaccgaaggagacaacgccaccttcacctgcagcttctccaacgcctcg
gagagcttcgtgctgaactggtaccgcatgagccccagcaaccagacggacaagctggct
gccttccccgaggaccgcagccagcccggccgggactgccgcttccgcgtcacacaactg
cccaacgggcgcgacttccacatgagcgtggtcagggcccggcgcaacgacagcggcacc
tacctctgcggggccatctccctggcccccaaggcgcagatcaaagagagcctgcgggca
gagctcagggtgacagagagaagggcagaagtgcccacagcccaccccagcccctcaccc
aggccagctggccagttccaagccctggtggttggtgtcgtgggcggcctgctgggcagc
ctggtgctgctagtctgggtcctggctgtcatctgctcccgggctgcacaagggaccata
gaagccaggcgcaccggccagcccctgaaggaggacccctcggccgtgcctgtgttctct
gtggactatggggagctggatttccagtggcgagagaagaccccggagcccccggcaccc
tgtgtccctgagcagacggagtacgccaccatcgtctttcctagtgggctgggcacctcg
tccccggcccgcaggggctcagccgacggccctcggagtccccggccactgaggcctgag
gatggacactgctcttggcccctctga

DBGET integrated database retrieval system