KEGG   Macaca mulatta (rhesus monkey): 100187576
Entry
100187576         CDS       T01028                                 

Gene name
MAMU-AG
Definition
(RefSeq) major histocompatibility complex, class I, AG precursor
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100187576 (MAMU-AG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100187576 (MAMU-AG)
   04145 Phagosome
    100187576 (MAMU-AG)
  09143 Cell growth and death
   04218 Cellular senescence
    100187576 (MAMU-AG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100187576 (MAMU-AG)
   04612 Antigen processing and presentation
    100187576 (MAMU-AG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100187576 (MAMU-AG)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100187576 (MAMU-AG)
   05330 Allograft rejection
    100187576 (MAMU-AG)
   05332 Graft-versus-host disease
    100187576 (MAMU-AG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100187576 (MAMU-AG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100187576 (MAMU-AG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100187576 (MAMU-AG)
   05170 Human immunodeficiency virus 1 infection
    100187576 (MAMU-AG)
   05168 Herpes simplex virus 1 infection
    100187576 (MAMU-AG)
   05163 Human cytomegalovirus infection
    100187576 (MAMU-AG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100187576 (MAMU-AG)
   05169 Epstein-Barr virus infection
    100187576 (MAMU-AG)
   05165 Human papillomavirus infection
    100187576 (MAMU-AG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100187576 (MAMU-AG)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    100187576 (MAMU-AG)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100187576 (MAMU-AG)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  100187576 (MAMU-AG)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 100187576
NCBI-ProteinID: NP_001127702
UniProt: O02948
LinkDB
AA seq 339 aa
MAVMAPRTLLLVLSGVLALTQPRAGSHSMRYFYTAVSRPGRGQPRFIAVGYVDDTQFVRF
DSDAESPRMEPRAPWVEQEGPEYWDRETQNMKTATQTYQANLRTLLRYYNQSEAGSHTFQ
KMYGCDLGPDGRLLRGYEQFAYDGRDYIILNEDLRSWTAADMAAQNTQRKWEAAGAAEQH
RTYLEGECLEWLGRYLENGKETLQRADPPKTNVTHHPVSDYEATLRCWALGFYPAEITLT
WQRDGEEQTEDTELVETRPTGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTILIVGIIAGLVLLGTVVTGAVVAAVMWRRKSSDR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctggtgctctcaggggtactggccctgacc
cagccccgggcgggctcgcactccatgaggtatttctacaccgccgtgtcccggcccggc
cgcgggcagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgagagtccgaggatggagccgcgggcgccgtgggtggagcaggagggt
ccagagtattgggaccgggagacacagaacatgaagaccgcgacacagacctaccaagcg
aacctgcggaccctgctccgctactacaaccagagcgaggccgggtctcacaccttccag
aagatgtatggctgcgacctggggccagacgggcgcctcctccgcgggtatgaacagttc
gcctacgacggcagggattacatcatcctgaacgaggacctgcgctcctggacggccgcg
gacatggcggctcagaacacccagcgcaagtgggaggcggcgggtgcggcggagcagcac
agaacctacctggagggcgagtgcctggagtggctcggcagatacctggagaacgggaag
gagacgctgcagcgcgcggacccccccaagacaaatgtgacccaccaccctgtctctgac
tacgaggccaccctgaggtgttgggccctcggcttctaccctgcggagatcacactgacc
tggcagcgggatggagaggaacaaactgaggacacagagctcgtggagaccaggcctaca
ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga
tacacctgtcatgtgcaacatgagggtctgcccgagcccctcaccttgagatgggagcca
tcttcccagtctaccatcctcatcgtaggcatcattgctggcctggttctccttggaact
gtggtcactggagctgtggttgctgctgtgatgtggaggaggaagagctcagatagataa

KEGG   Macaca mulatta (rhesus monkey): 100424348
Entry
100424348         CDS       T01028                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100424348
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100424348
   04145 Phagosome
    100424348
  09143 Cell growth and death
   04218 Cellular senescence
    100424348
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100424348
   04612 Antigen processing and presentation
    100424348
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100424348
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100424348
   05330 Allograft rejection
    100424348
   05332 Graft-versus-host disease
    100424348
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100424348
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100424348
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100424348
   05170 Human immunodeficiency virus 1 infection
    100424348
   05168 Herpes simplex virus 1 infection
    100424348
   05163 Human cytomegalovirus infection
    100424348
   05167 Kaposi sarcoma-associated herpesvirus infection
    100424348
   05169 Epstein-Barr virus infection
    100424348
   05165 Human papillomavirus infection
    100424348
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100424348
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    100424348
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100424348
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  100424348
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 100424348
NCBI-ProteinID: XP_028698445
Ensembl: ENSMMUG00000041305
LinkDB
Position
4
AA seq 402 aa
MAPRTVLLLLSGALALTETWAGSHSLRYFSTAVSRPGRGEPRFISVGYVDDTQFLRFDSD
AASPRMEPRAPWAEQEGPEYWEEQTGLAKDITQSFRVGLGNLRGYYNQSEAGSHTLQWMY
GCDLGPDGRLLRGYHQFAYDGKDYIALNGDLRSWTAADTAAQITQRKWEAAREAEQMRAY
LEGTCLEWLRRHMENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQR
DGEDQTQDTELVETRPVGDGTFQKWAAVVVSSGEEQRYTCHVQHKGLPEPLTLRWEPSSQ
STIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGHFLATGGRGGSYSLLTCRSYTSPAC
KWWGWECGEPHPSRNSSCPTSPVGSDKVLFLFYPSQRQCPGL
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggcgccccgaaccgtcctcctgctgctctcgggggccctggccctgaccgagacctgg
gccggctcgcactccttgaggtatttcagcaccgccgtgtcccggcccggccgcggggag
ccccgcttcatctccgtgggctacgtggacgacacgcagttcctgcggttcgacagcgac
gccgcgagtccgaggatggagccgcgggcgccgtgggcggagcaggaggggccggagtat
tgggaagagcagacagggctcgccaaggacatcacacagtccttccgagtgggtctgggg
aacctgcgcggctactacaaccagagcgaggcggggtctcacaccctccagtggatgtat
ggctgcgacctggggcccgacgggcgcctcctccgcgggtatcaccagttcgcctacgac
ggcaaggattacatcgccctgaacggagacctgcgttcctggaccgcggcagacacggcg
gctcagataacccagcgcaagtgggaggcggcccgcgaggcagagcagatgagagcctac
ctggaggggacgtgcctggagtggctccgcagacacatggagaacgggaaggagacgctg
cagcgcgcggaccccccaaagacacacgtgacccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggaccaaactcaggacaccgagcttgtggagaccaggccagtaggagatgga
accttccagaagtgggcagctgtggtggtgtcttctggagaagagcagagatacacgtgc
catgtgcagcataaggggctgccggagcccctcaccctgagatgggagccatcttcccag
tccaccatccccatcgtgggcatcgttgctggcctggctgtcctagcagttgtggtcact
ggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggacattttcttgctaca
ggtggaagaggagggagctactctctccttacatgcaggagctacacttctcctgcgtgt
aagtggtgggggtgggagtgtggagaacctcacccatcccgtaattcctcctgtcccacg
tctcctgtgggctctgacaaggtcctgtttttgttctaccccagccagcgacagtgccca
gggctctga

KEGG   Macaca mulatta (rhesus monkey): 100426197
Entry
100426197         CDS       T01028                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0101 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100426197
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100426197
   04145 Phagosome
    100426197
  09143 Cell growth and death
   04218 Cellular senescence
    100426197
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100426197
   04612 Antigen processing and presentation
    100426197
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100426197
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100426197
   05330 Allograft rejection
    100426197
   05332 Graft-versus-host disease
    100426197
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100426197
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100426197
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100426197
   05170 Human immunodeficiency virus 1 infection
    100426197
   05168 Herpes simplex virus 1 infection
    100426197
   05163 Human cytomegalovirus infection
    100426197
   05167 Kaposi sarcoma-associated herpesvirus infection
    100426197
   05169 Epstein-Barr virus infection
    100426197
   05165 Human papillomavirus infection
    100426197
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100426197
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    100426197
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   100426197
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  100426197
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2 HCV_NS4a
Other DBs
NCBI-GeneID: 100426197
NCBI-ProteinID: XP_028698442
LinkDB
Position
4
AA seq 404 aa
MRVMAPGSLLLLLSGALALTETRASECGVGRETASAGRSEGTAGGGAGPGEPRGEEGRAG
LSLSSPPGSHSMRYFSTAVSRPDRREPWYLEVGYVDDTHFVRFDSDVESPRMEPRAPWIE
QEGPEYWEEETRRAKGNAQTFRVNLGTALRYYNQSQGGSHTIQGMYGCDLGPDGRLLRGY
HQHAYDGKDYIALNEDLNSWTAADVAAQNTQRKWEAAGVAEKLRAYLEGRCLEWLRRYLE
NGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEEQTQDTELVET
RPGGDGTFQKWAAVVVPSGEEQRYTCHVQHQGLPEPLTLRWEPSSQSTIPIVGIVAGLAV
LAVVTGAVVAAVMWRRKSSGGKGGSYSQAASNDSAQGSDVSLTA
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgcccggatccctccttctcctgctctcgggggccctggccctgacc
gaaacccgggccagtgagtgcggggtcgggagggaaacggcctctgcggggaggagcgag
gggaccgcaggcgggggcgcaggacccggggagccgcgcggggaggagggtcgggcgggt
ctcagcctctcctcgcccccaggctcccactccatgaggtatttcagcaccgccgtgtcc
cggcccgaccgccgggaaccctggtatctcgaagtcggctacgtggacgacacgcatttc
gtgcggttcgacagcgacgtcgagagtccgaggatggagccgcgggcgccgtggatagag
caggaggggccggagtattgggaagaggagacacggagagccaagggcaacgcacagact
ttccgagtgaacctggggaccgcactccgctactacaaccagagccagggggggtctcac
accatccaggggatgtacggctgtgacctgggacccgacgggcgcctcctccgcgggtat
caccagcacgcctacgacggcaaggattacatcgccctgaacgaggacctaaactcctgg
accgccgcggacgtggcggctcagaacacccagcgcaagtgggaggcggccggtgtggcg
gagaagctgagagcctacctggagggccggtgcctggagtggctccgcagatacctggag
aacgggaaggagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccatccc
gtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatc
acactgacctggcagcgggatggggaggagcaaactcaggacaccgagcttgtggagacc
aggccaggaggagatggaaccttccagaagtgggcagctgtggtggtgccttctggagaa
gagcagagatacacgtgccatgtacagcaccaggggctgccggagcccctcaccctgaga
tgggagccatcttcccagtccaccatccccatcgtgggcatcgttgctggcctggctgtc
ctagcagttgtcaccggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggt
ggaaaaggagggagctactctcaggctgcgtccaacgacagtgcccagggctctgatgtg
tctctcacggcttga

KEGG   Macaca mulatta (rhesus monkey): 106995452
Entry
106995452         CDS       T01028                                 

Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    106995452
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106995452
   04145 Phagosome
    106995452
  09143 Cell growth and death
   04218 Cellular senescence
    106995452
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106995452
   04612 Antigen processing and presentation
    106995452
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106995452
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106995452
   05330 Allograft rejection
    106995452
   05332 Graft-versus-host disease
    106995452
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106995452
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106995452
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106995452
   05170 Human immunodeficiency virus 1 infection
    106995452
   05168 Herpes simplex virus 1 infection
    106995452
   05163 Human cytomegalovirus infection
    106995452
   05167 Kaposi sarcoma-associated herpesvirus infection
    106995452
   05169 Epstein-Barr virus infection
    106995452
   05165 Human papillomavirus infection
    106995452
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    106995452
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    106995452
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   106995452
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  106995452
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 106995452
NCBI-ProteinID: XP_028698716
LinkDB
Position
Unknown
AA seq 408 aa
MRVVAPRTLLLLLSGILALTKTWAGECGVGRETASAGRSEETADGGAGPEEPRGEEGRAG
LSLSSPPGSHSLRYFYTTVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWME
QEGPEYWEEQTRIAKANAQTDRADLGILRGYYNQSEAGSHTIQTMYGCDLRPDGRLLRGY
YQDAYDGKDYIALNRDLRSWTAADMAAQNTQRKWEAAGEAEQWRAYLEGECVESLRRYLE
NGKEMLQRANPPKTHVTHHPISNHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET
RPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQSTIPIVGIVAGLAV
LAVMVTGAVVAAVMWRRKSSGGKGGSYSQATSSNSAQGSDVSLTALKA
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcgggtcgtggcgccccgaaccctcctcctgctgctctcggggatcctggccctgacc
aagacctgggccggtgagtgcggggtcgggagggaaacggcctctgcggggaggagcgag
gagaccgcagacgggggcgcaggacccgaggagccgcgcggggaggagggtcgggcgggt
ctcagcctctcctcgcccccaggctcgcactccttgaggtatttctacaccaccgtgtcc
cggcccggccgcggggagccccgcttcatctccgtgggctacgtggacgacacgcagttc
gtgcggttcgacagcgacgccgagagtccgagagaggagccgcgggcgccgtggatggag
caggaggggccggagtattgggaagagcagacacggatcgccaaggccaacgcacagact
gaccgagcggacctggggatcctgcgcggctactacaaccagagcgaggcggggtctcac
accatccagacgatgtatggctgcgacctgagacccgacggacgcctcctccgcgggtat
taccaggacgcctacgacggcaaagattacatcgccctgaaccgggacctgcgctcctgg
accgccgcggacatggcggctcagaacacccagcggaagtgggaagcggccggtgaggca
gagcagtggagagcctatctggagggcgagtgcgtggagtcgcttcgcagatacctggag
aacgggaaggagatgctgcagcgcgcgaatcccccaaagacacacgtgacccaccacccc
atctctaaccatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatc
acactgacctggcagcgggatggggaggaccaaactcaggacactgagcttgtggagacc
aggccaggaggagatggaaccttccagaagtggggagctgtggtggtgccttctggagaa
gagcagagatacacgtgccatgtgcagcatgaggggctaccggagcccctcaccctgaga
tgggagccatcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtc
ctagcagttatggtcaccggagctgtggtcgctgctgtgatgtggaggaggaagagctca
ggtggaaaaggagggagctactctcaggctacatccagcaacagtgcccagggatctgat
gtgtctctcacggctttaaaggcctga

KEGG   Macaca mulatta (rhesus monkey): 106996627
Entry
106996627         CDS       T01028                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    106996627
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106996627
   04145 Phagosome
    106996627
  09143 Cell growth and death
   04218 Cellular senescence
    106996627
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106996627
   04612 Antigen processing and presentation
    106996627
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106996627
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106996627
   05330 Allograft rejection
    106996627
   05332 Graft-versus-host disease
    106996627
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106996627
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106996627
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106996627
   05170 Human immunodeficiency virus 1 infection
    106996627
   05168 Herpes simplex virus 1 infection
    106996627
   05163 Human cytomegalovirus infection
    106996627
   05167 Kaposi sarcoma-associated herpesvirus infection
    106996627
   05169 Epstein-Barr virus infection
    106996627
   05165 Human papillomavirus infection
    106996627
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    106996627
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    106996627
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   106996627
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  106996627
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig
Other DBs
NCBI-GeneID: 106996627
NCBI-ProteinID: XP_028703564
LinkDB
Position
4
AA seq 439 aa
MGCRMSREANQRRRGLSSKVPTRPPGLRVSSDAEMRVMAPRTLLLLLSGALALTETWAGE
CGVRRETASAGRSEGTAGGGAGPGEPRGEEGRAGLSLSSPPGSHSLRYFTTAVSRPGRGE
PRFIVVGYVDDTQFVRFDSYAESPRMEPRAPWMEQEGPEYWEEQTRIVKDNAQTFRVDLG
TLRGYYNQSEAGSHTIQTMYGCDLGPDGRLLRGYYQDAYDGRDYIALNEDLRSWTAADEA
AQNTQRKWEAAGVAEQWRAYLEGKCVECLRRYLENGKEMLQRADPPKTHVTHHPVSDHEA
TLRCWALGFYPAEISLTWRQDGEEQTQDTELVETRPAGDGTFQKWGAVVVPSGEEQRYTC
HVQHEGLLEPLTLRWEPSSQSSIPIVGIVAGLAVLAVVVTGAVVAAVMRRRKSSGGKGGS
YSQAASSDSAQGSDVSLTA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggggtgtcggatgtctagagaagccaatcagcgtcgccgcggtctcagttctaaagtc
cccacgcgcccacccggactcagagtctcctcagacgccgagatgcgggtcatggcgccc
cgaaccctcctcttgctgctctcgggggccctggccctgaccgagacctgggccggtgag
tgcggggtccggagggaaacggcctctgcggggaggagcgaggggaccgcaggcgggggc
gcaggacccggggagccgcgcggggaggagggtcgggcgggtctcagcctctcctcgccc
ccaggctcgcactccttgaggtatttcaccaccgccgtgtcccggcccggccgcggggag
ccccgcttcatcgtcgtgggctacgtggacgacacgcagttcgtgcggttcgacagctac
gccgagagtccgaggatggagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggaagagcaaacacggatcgtcaaggacaacgcacagactttccgagtggacctgggg
accctgcgcggctactacaaccagagcgaggcggggtctcacaccatccagacgatgtac
ggctgcgacctggggcccgacgggcgcctcctccgcgggtattaccaggacgcctacgac
ggcagggattacatcgccctgaacgaggacctgcgctcctggaccgctgcggatgaggcg
gctcagaacacccagcgcaagtgggaggcggccggtgtggcggagcagtggagagcctac
ctggagggcaagtgcgtggagtgtctccgcagatacctggagaacgggaaggagatgctg
cagcgcgcggatcccccaaagacacatgtgacccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggtttctaccctgcggagatctcactgacctggcggcag
gatggggaggagcaaactcaggacaccgagcttgtggagaccaggccagcaggagatgga
accttccagaagtggggagctgtggtggtgccttctggagaagagcagagatacacatgc
catgtgcagcatgaggggctgctggagcccctcaccttgagatgggagccatcttcccag
tccagcatccccatcgtgggcattgttgctggcctggctgtcctagcagttgtagtcact
ggagctgtggtcgctgctgtgatgaggaggaggaagagctcaggcggaaaaggagggagc
tactctcaggctgcgtccagcgacagtgcccagggctctgatgtgtctctcacggcttga

KEGG   Macaca mulatta (rhesus monkey): 106996676
Entry
106996676         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-46 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    106996676
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106996676
   04145 Phagosome
    106996676
  09143 Cell growth and death
   04218 Cellular senescence
    106996676
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106996676
   04612 Antigen processing and presentation
    106996676
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106996676
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106996676
   05330 Allograft rejection
    106996676
   05332 Graft-versus-host disease
    106996676
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106996676
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106996676
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106996676
   05170 Human immunodeficiency virus 1 infection
    106996676
   05168 Herpes simplex virus 1 infection
    106996676
   05163 Human cytomegalovirus infection
    106996676
   05167 Kaposi sarcoma-associated herpesvirus infection
    106996676
   05169 Epstein-Barr virus infection
    106996676
   05165 Human papillomavirus infection
    106996676
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    106996676
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    106996676
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   106996676
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  106996676
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_C C2-set_2 ig Ig_2 MATalpha_HMGbox
Other DBs
NCBI-GeneID: 106996676
NCBI-ProteinID: XP_028698458
LinkDB
Position
4
AA seq 373 aa
MAPRTLLLLLSGALALTETWAGSHSLRYFSTAVSRPGRGEPRFISVGYVDDTQFLRFDSD
AASPRMEPRAPWAEQEGPEYWEEQTGLAKDITQSFRVGLGNLRGYYNQSEAGSHTLQWMY
GCDLGPDGRLLHGYHQFAYDGKDYIALNVDLRSWTAADMAAQNTQRKWEAAREAERMRAH
LEGTCVEWLLRHMENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQR
DGEDQTQDTELVETRPVGDGTFQKWAAVVVPSGEEQRYTCHVQHKGLPEPLTLRWEPSSQ
STIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGHFLATGGKXGSYSLLTCRSYTSPAS
SDSAQGSDVCLTA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggcgccgcgaaccctcctcctgctgctctcgggggccctggccctgaccgagacctgg
gccggctcgcactccttgaggtatttcagcaccgccgtgtcccggcccggccgcggggag
ccccgcttcatctccgtgggctacgtggacgacacgcagttcctgcggttcgacagcgac
gccgcgagtccgaggatggagccgcgggctccgtgggcggagcaggaggggccggagtat
tgggaagagcagacagggctcgccaaggacatcacacaatctttccgagtgggcctgggg
aacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccagtggatgtac
ggctgcgacctggggcccgacgggcgccttctccacgggtatcaccagttcgcctacgac
ggcaaggattacatcgccctgaacgtggacctgcgctcctggaccgcggcggacatggcg
gctcagaacacccagcgcaagtgggaggcggcccgcgaggcagagcggatgagagcccac
ctggaggggacgtgcgtggagtggctcctcagacacatggagaacgggaaggagacgctg
cagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggaccaaactcaggacaccgagcttgtggagaccaggccagtaggagatgga
accttccagaagtgggcagctgtggtggtgccttctggagaagagcagagatacacgtgc
catgtgcagcataaggggctgccggagcccctcaccctgagatgggagccatcttcccag
tccaccatccccatcgtgggcatcgttgctggcctggctgtcctagcagttgtggtcact
ggagctgtggtcgctgctgtgatgtggaggaggaagagctcaggacattttcttgctaca
ggtggaaagngagggagctactctctccttacatgcaggagctacacttctcctgcgtcc
agtgacagtgcccagggctctgatgtgtgtctcacggcttga

KEGG   Macaca mulatta (rhesus monkey): 106997893
Entry
106997893         CDS       T01028                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-15 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    106997893
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106997893
   04145 Phagosome
    106997893
  09143 Cell growth and death
   04218 Cellular senescence
    106997893
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    106997893
   04612 Antigen processing and presentation
    106997893
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    106997893
  09163 Immune disease
   05320 Autoimmune thyroid disease
    106997893
   05330 Allograft rejection
    106997893
   05332 Graft-versus-host disease
    106997893
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106997893
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    106997893
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106997893
   05170 Human immunodeficiency virus 1 infection
    106997893
   05168 Herpes simplex virus 1 infection
    106997893
   05163 Human cytomegalovirus infection
    106997893
   05167 Kaposi sarcoma-associated herpesvirus infection
    106997893
   05169 Epstein-Barr virus infection
    106997893
   05165 Human papillomavirus infection
    106997893
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    106997893
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    106997893
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   106997893
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  106997893
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig CYYR1
Other DBs
NCBI-GeneID: 106997893
NCBI-ProteinID: XP_028698841
LinkDB
Position
Unknown
AA seq 405 aa
MRVMAPRTLLLLLSGALALTETWAGECGVGREMASAGRSEGTAGGGAGPGEPRGEEGRAG
LSLSSPPGSHSMRYFSTAVSRPDRGEPRFIAVGYVDDTQFVRFDSDAESPRMEPRARWIE
QEGPEYWEEETRKAKDITQSFRVSLGNLRGYYNQSEGGSHTYQWMVGCNVGPDGHLLRGY
HQYAYDGKDYIALNEDLRSWTAADVAAQNTQRKWEAVGGAERFRAYVEGRCVESLRRYLE
NGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQREGEDQTQDTELVET
RPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQSTIPIVGIVVGLAV
LAVVVTGAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggtgagtgcggggtcgggagggaaatggcctctgcggggaggagcgag
gggaccgcaggcgggggcgcaggacccggggagccgcgcggggaggagggtcgggcgggt
ctcagcctctcctcgcccccaggctcccactccatgaggtatttcagcaccgccgtgtcc
cggcccgaccgcggggagccccgattcatcgccgtgggctacgtggacgacacgcagttc
gtgcggttcgacagcgacgccgagagtccgaggatggagccgcgggcgcggtggatagag
caggaggggccggagtattgggaagaggagacacggaaagccaaggacatcacacagtct
ttccgagtgagcctggggaacctgcgcggctactacaaccagagcgagggggggtctcac
acctaccagtggatggttggctgcaacgtgggaccagacgggcacctcctccgcgggtat
caccagtacgcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctgg
accgccgcggacgtggcggctcagaacacccagcggaagtgggaggcggtcggtggggca
gagcggttcagagcctacgtggagggccggtgcgtggagtcgctccgcagatacctggag
aacgggaaggagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccacccc
gtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatc
acactgacttggcagcgggaaggggaggaccaaactcaggacaccgagcttgtggagacc
aggccaggaggagatggaaccttccagaagtggggagctgtggtggtgccttctggagaa
gagcagagatacacgtgccatgtgcagcacgaggggctgccagaacccctcaccctgaga
tgggagccatcttcccagtccaccatccccatcgtgggcatcgttgttggcctggctgtc
ctagcagttgtggtcaccggagctgtggtcgcagctgtgatgtgtaggaggaagagctca
ggtggaaaaggagggagctactctcaggctgcgtccagcgacagtgcccagggctctgat
gtgtctctcacggcttga

KEGG   Macaca mulatta (rhesus monkey): 114676051
Entry
114676051         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-14 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    114676051
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114676051
   04145 Phagosome
    114676051
  09143 Cell growth and death
   04218 Cellular senescence
    114676051
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    114676051
   04612 Antigen processing and presentation
    114676051
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    114676051
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114676051
   05330 Allograft rejection
    114676051
   05332 Graft-versus-host disease
    114676051
  09166 Cardiovascular disease
   05416 Viral myocarditis
    114676051
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    114676051
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114676051
   05170 Human immunodeficiency virus 1 infection
    114676051
   05168 Herpes simplex virus 1 infection
    114676051
   05163 Human cytomegalovirus infection
    114676051
   05167 Kaposi sarcoma-associated herpesvirus infection
    114676051
   05169 Epstein-Barr virus infection
    114676051
   05165 Human papillomavirus infection
    114676051
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    114676051
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    114676051
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   114676051
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  114676051
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 ig
Other DBs
NCBI-GeneID: 114676051
NCBI-ProteinID: XP_028698840
LinkDB
Position
Unknown
AA seq 474 aa
MSREANQRRRGLCSKVLTRPSGLRVSSDAKMRVMAPRTLLLLLSGALALTETWAGSHSMR
YFSTSVSRPDRGEPRFIAVGYVDDTQFVRFDSDAESPRMEPRARWIEQEGPEYWEEETRK
AKDTTQSFRVSLGNLRGYYNQSEGGEWPRPGAQVTTPPHPHGRPGSPRVSGSEIXPRGRG
TRPDPRPGRAPGAFTRLHFQWRPKSPRVGRGGAGLXGDGLTAGAGPGSHTYQWMYGCNVG
PDGHLLRGYHQFAYDGKDYIALNEDLRSWTAGDMAAQNTQRKWEAVGGAERFRAYVEGRC
VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQ
TQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQSTIPI
VGIVVGLAVLAVVVTGAVVAAVMCRRKSSGGKGGSYSQAASSDSAQGSDVSLTA
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtctagagaagccaatcagcgtcgtcgcggtctctgttctaaagtcctcacgcgccca
tccgggctcagagtctcctcagacgccaagatgcgggtcatggcgccccgaaccctcctc
ctgctgctctcgggggccctggccctgaccgagacctgggccggctcccactccatgagg
tatttcagcacctccgtgtcccggcccgaccgcggggagccccgattcatcgccgtgggc
tacgtggacgacacgcagttcgtgcggttcgacagcgacgccgagagtccgaggatggag
ccgcgggcgcggtggatagagcaggaggggccggagtattgggaagaggagacacggaaa
gccaaggacaccacacagtctttccgagtgagcctggggaacctgcgcggctactacaac
cagagcgaggggggtgagtggccccggccgggggcgcaggtcacgacccctccccatccc
cacggacggcccgggtctccccgagtctccgggtccgagatcncgccccgaggccgcggg
acccgcccagaccctcgaccggggagagccccaggcgcctttacccggcttcattttcag
tggaggccaaagtccccgcgggttggtcggggcggggcgggactcnncggggacgggctg
accgcgggggcggggccagggtctcacacctaccagtggatgtatggctgcaacgtggga
ccagacgggcacctcctccgcgggtatcaccagttcgcctacgacggcaaggattacatc
gccctgaacgaggacctgcgctcctggaccgccggggacatggcggctcagaacacccag
cgcaagtgggaggcggtcggtggggcagagcggttcagagcctacgtggagggccggtgc
gtggagtggctccgcagatacctggagaacgggaaggagacgctgcagcgcgcggatccc
ccaaagacacacgtgacccaccaccccgtctctgaccatgaggccaccctgaggtgctgg
gccctgggcttctaccctgcggagatcacactgacctggcagcgggatggggaagaccaa
actcaggacaccgagcttgtggagaccaggccaggaggagatggaaccttccagaagtgg
ggagctgtggtggtgccttctggagaagagcagagatacacgtgccatgtgcagcacgag
gggctgccagaacccctcaccctgagatgggagccatcttcccagtccaccatccccatc
gtgggcatcgttgttggcctggctgtcctagcagttgtggtcaccggagctgtggtcgca
gctgtgatgtgtaggaggaagagctcaggtggaaaaggagggagctactctcaggctgcg
tccagcgacagtgcccagggctctgatgtgtctctcacagcttga

KEGG   Macaca mulatta (rhesus monkey): 114677644
Entry
114677644         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0103 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    114677644
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114677644
   04145 Phagosome
    114677644
  09143 Cell growth and death
   04218 Cellular senescence
    114677644
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    114677644
   04612 Antigen processing and presentation
    114677644
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    114677644
  09163 Immune disease
   05320 Autoimmune thyroid disease
    114677644
   05330 Allograft rejection
    114677644
   05332 Graft-versus-host disease
    114677644
  09166 Cardiovascular disease
   05416 Viral myocarditis
    114677644
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    114677644
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    114677644
   05170 Human immunodeficiency virus 1 infection
    114677644
   05168 Herpes simplex virus 1 infection
    114677644
   05163 Human cytomegalovirus infection
    114677644
   05167 Kaposi sarcoma-associated herpesvirus infection
    114677644
   05169 Epstein-Barr virus infection
    114677644
   05165 Human papillomavirus infection
    114677644
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    114677644
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    114677644
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   114677644
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  114677644
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Podoplanin
Other DBs
NCBI-GeneID: 114677644
NCBI-ProteinID: XP_028703574
LinkDB
Position
4
AA seq 361 aa
MRXMAPRTLLLLLSGALALTETWAGSHSLRYFGTAVSRPGRGEPRFTYVGYVDDTQFVRF
DSDAASPRVEPRAPWMEQEGPEYWEEQTRIAKARAQTDRADLGTLLRYYNQSEAGSHTIQ
WMFGCDLGPDGRLLRGYHQSAYDGKDYIALNRDLSSWTAADLVAQNTQRKWEADRYAERQ
RAYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLLEPLTLKWEP
SSQSTIPIVGIVVGLAVLAVVVTGAVVAAVMWRRKSSGGRGSYSQAVSNDSAQGSDVSLT
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgcggntcatggcgccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacctgggccggctcgcactccttgaggtatttcggcaccgccgtgtcccggcccggc
cgcggggagccccgcttcacctacgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagggtggagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaagagcagacacggatcgccaaggcccgcgcacagactgaccgagcg
gacctggggaccctgctccgctactacaaccagagcgaggccgggtctcacaccatccag
tggatgtttggctgcgacctggggcccgacgggcgcctcctccgcgggtatcaccagtcc
gcctacgacggcaaggattacatcgccctgaaccgggacctgagctcctggactgccgcg
gacttggtggctcagaacacccagcgcaagtgggaggcggaccgttatgcggagcggcag
agagcctacctggagggcgagtgcctggagtggctccgcagatacttggagaacgggaag
gagacgctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggatcaaactcaggacaccgaacttgtggagactaggccagca
ggagatggaaccttccagaagtggggagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggctgctggagccactcaccctgaaatgggagcca
tcttcccagtccaccatccccatcgtgggcattgttgttggcctggctgtcctagcagtt
gtagttaccggagctgtggtcgctgctgtgatgtggagaaggaagagctcaggcggaaga
gggagctactctcaggctgtgtccaacgacagtgcccagggctctgatgtgtctctcacg
gcttga

KEGG   Macaca mulatta (rhesus monkey): 694372
Entry
694372            CDS       T01028                                 

Definition
(RefSeq) class I histocompatibility antigen, Gogo-B*0103 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    694372
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    694372
   04145 Phagosome
    694372
  09143 Cell growth and death
   04218 Cellular senescence
    694372
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    694372
   04612 Antigen processing and presentation
    694372
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    694372
  09163 Immune disease
   05320 Autoimmune thyroid disease
    694372
   05330 Allograft rejection
    694372
   05332 Graft-versus-host disease
    694372
  09166 Cardiovascular disease
   05416 Viral myocarditis
    694372
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    694372
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    694372
   05170 Human immunodeficiency virus 1 infection
    694372
   05168 Herpes simplex virus 1 infection
    694372
   05163 Human cytomegalovirus infection
    694372
   05167 Kaposi sarcoma-associated herpesvirus infection
    694372
   05169 Epstein-Barr virus infection
    694372
   05165 Human papillomavirus infection
    694372
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    694372
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    694372
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   694372
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  694372
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 694372
NCBI-ProteinID: XP_028703569
LinkDB
Position
4
AA seq 405 aa
MRVMAPRTLLLLLSGALALTETRAGECGVGREMASAGRSEGTAGGGAGPGEPRGEEGRAG
LSLSSPPGSHSMRYFSTSVSRPGRREPWHLEVGYVDDTQFVRFDSDAESPRMEPRAPWAE
QEGPEYWEEQTRIAKGHAQTERGNLRTALRYYNQSEGGSHTIQWMYGCDLGPDGRLLRGY
HQLAYDGKDYIALNEDLRSWTAADMTARFTQRKWEAAREAERWRAYLEGECLEWLSRYLE
NGKETLQRADPPKTYVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVET
RPGGDGTFQKWGAVVVPSGEEQRYTCHVQHEGLPEPLTLRWGPPSQSTIPIVGIVAGLAV
LAVVVTGAVVAAVMWRRKSSGGKGGSYFQAASKDSPQGSDESLMA
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcgggggccctggccctgacc
gagacccgggccggtgagtgcggggtcgggagggaaatggcctctgcggggaggagcgag
gggaccgcaggcgggggcgcaggacccggggagccgcgcggggaggagggtcgggcgggt
ctcagcctctcctcgcccccaggctcgcactccatgaggtatttcagcacctccgtgtcc
cggcccggccgccgggagccctggcatctcgaagtcggctacgtggacgacacgcagttc
gtgcggttcgacagcgacgccgagagtccgaggatggagccgcgggcgccgtgggcggag
caggaggggccggagtattgggaagagcagacacggatcgccaagggccacgcacagact
gagcgagggaacctgcggaccgcgctccgctactacaaccagagcgagggggggtctcac
accatccagtggatgtatggctgcgacctgggacccgacgggcgcctcctccgcgggtat
caccagttagcctacgacggcaaggattacatcgccttgaacgaggacctgcgctcctgg
accgccgcggacatgacggctcggttcacccagcgcaagtgggaggcggcccgtgaggcg
gagcggtggagagcctacctggagggcgagtgcctggagtggctcagcagatacctggag
aacgggaaggagacgctgcagcgcgcggatcccccaaagacatacgtgacccaccacccc
gtctctgaccatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatc
acactgacctggcagcgggatggggaggatcaaactcaggacaccgaacttgtggagacc
aggccaggaggagatggaaccttccaaaagtggggagctgtggtggtgccttctggagaa
gagcagagatacacgtgccatgtgcagcatgaggggctgccggagcccctcaccctgaga
tgggggccaccttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtc
ctagcagttgtggtcactggagctgtggtcgctgctgtgatgtggaggaggaagagctca
ggtggaaaaggagggagctactttcaggctgcatccaaggacagtccccagggctctgat
gagtctctcatggcttga

KEGG   Macaca mulatta (rhesus monkey): 699243
Entry
699243            CDS       T01028                                 

Gene name
MAMU-A3
Definition
(RefSeq) major histocompatibility complex, class I, A isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    699243 (MAMU-A3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    699243 (MAMU-A3)
   04145 Phagosome
    699243 (MAMU-A3)
  09143 Cell growth and death
   04218 Cellular senescence
    699243 (MAMU-A3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    699243 (MAMU-A3)
   04612 Antigen processing and presentation
    699243 (MAMU-A3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    699243 (MAMU-A3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    699243 (MAMU-A3)
   05330 Allograft rejection
    699243 (MAMU-A3)
   05332 Graft-versus-host disease
    699243 (MAMU-A3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    699243 (MAMU-A3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    699243 (MAMU-A3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    699243 (MAMU-A3)
   05170 Human immunodeficiency virus 1 infection
    699243 (MAMU-A3)
   05168 Herpes simplex virus 1 infection
    699243 (MAMU-A3)
   05163 Human cytomegalovirus infection
    699243 (MAMU-A3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    699243 (MAMU-A3)
   05169 Epstein-Barr virus infection
    699243 (MAMU-A3)
   05165 Human papillomavirus infection
    699243 (MAMU-A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    699243 (MAMU-A3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    699243 (MAMU-A3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   699243 (MAMU-A3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  699243 (MAMU-A3)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 699243
NCBI-ProteinID: XP_028702737
Ensembl: ENSMMUG00000019888
LinkDB
Position
4
AA seq 392 aa
MAVMAPRTLLLVLSGALTQTWAGSHSMRYFYTSMSRPGRGEPRFIAVGYVDDTQFVQFDS
DAASQRMEPRAPWVEQEGPEYWDRETRNMKTATQNAPVALRNLLRYYNQSEAGSHTFQRM
VGCDLGPDGRLQRGYEQFAYDGRDYIALNEDLRSWFAADVAAQNTQRKWEAAGVAEQDRV
YLEGRCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQ
RDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEQRYTCHVQHEGLPKPLTLRWEPSS
QSTIPIMGIIAGLVLLGAVVTGAVVAAAMWRRKSSDRKGGSYSQAASSDSAQGSDVSLTA
CKGETLGGLISVGCWGEQWTQLCCGVSLTWMY
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctggtgctctcaggggccctgacccagacc
tgggccggctctcactccatgaggtatttctacacctccatgtcccggcccggccgcggg
gagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcagttcgacagc
gacgccgcgagccagaggatggagccgcgggcgccgtgggtggagcaggaggggccggag
tattgggaccgggagacacggaacatgaagaccgcgacacagaatgccccagtggccctg
cggaacctgctccgctactacaaccagagcgaggccgggtctcacaccttccagaggatg
gttggctgcgacctgggacccgacgggcgcctccaacgcgggtatgaacagttcgcctac
gacggcagggattacatcgccctgaacgaggacctgcgctcctggttcgcggcggatgtg
gcggctcagaacacccagcggaagtgggaggcggcgggtgtggcggagcaggacagagtc
tacctggagggccggtgcgtggagtggctccgcagatacctggagaacgggaaggagacg
ctgcagcgcgcggacccccccaagacacatgtgacccaccaccccgtctctgaccatgag
gccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcag
cgggatggggaggaccaaactcaggacacggagctcgtggagaccaggcctgcaggagat
ggaaccttccagaagtgggcggctgtggtggtgccttctggaaaggagcagagatacacc
tgtcatgtgcagcatgagggtctgcccaagcccctcaccctgagatgggagccgtcttcc
cagtccaccatccccatcatgggcatcattgctggcctggttctccttggagctgtggtc
actggagctgtggtcgctgctgcgatgtggaggaggaagagctcagatagaaaaggaggg
agctactctcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctcacggct
tgtaaaggtgagaccctggggggcctgatatctgtggggtgttggggggaacagtggacg
cagctgtgctgtggggtttctttgacttggatgtattga

KEGG   Macaca mulatta (rhesus monkey): 709076
Entry
709076            CDS       T01028                                 

Gene name
MAMU-F
Definition
(RefSeq) mamu class I histocompatibility antigen, alpha chain F precursor
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    709076 (MAMU-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    709076 (MAMU-F)
   04145 Phagosome
    709076 (MAMU-F)
  09143 Cell growth and death
   04218 Cellular senescence
    709076 (MAMU-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    709076 (MAMU-F)
   04612 Antigen processing and presentation
    709076 (MAMU-F)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    709076 (MAMU-F)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    709076 (MAMU-F)
   05330 Allograft rejection
    709076 (MAMU-F)
   05332 Graft-versus-host disease
    709076 (MAMU-F)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    709076 (MAMU-F)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    709076 (MAMU-F)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    709076 (MAMU-F)
   05170 Human immunodeficiency virus 1 infection
    709076 (MAMU-F)
   05168 Herpes simplex virus 1 infection
    709076 (MAMU-F)
   05163 Human cytomegalovirus infection
    709076 (MAMU-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709076 (MAMU-F)
   05169 Epstein-Barr virus infection
    709076 (MAMU-F)
   05165 Human papillomavirus infection
    709076 (MAMU-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    709076 (MAMU-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    709076 (MAMU-F)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   709076 (MAMU-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  709076 (MAMU-F)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 MHC_I_3 ig DUF357
Other DBs
NCBI-GeneID: 709076
NCBI-ProteinID: NP_001036235
Ensembl: ENSMMUG00000008799
UniProt: P33617 D7RD86
LinkDB
Position
4
AA seq 348 aa
MAPRTLLLVLSGALALTETWAGSHSLRYFSTAVSRPGRREPQYRYIAVEYVDDTQFLRFD
SDAAIPRMEPRAPWVEQEGPQYWERTTGYAKANARTDRVALRKLLLRYNQSEAGSHTLQG
MNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVARITQRFYEAEEYAEEFR
TYLEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDREATLRCWALGFYPAEITLTW
QRDGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPQPLTLRWESS
SQPTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSDRNRGSYSQPTM
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggcgccccgaaccctcctcctggtgctctcaggggccctggccctgaccgagacctgg
gcgggctcccactccttgcggtattttagcaccgctgtgtcgcggcccggccgcagggag
cctcagtacaggtacatcgcggtggagtacgtggacgacacgcagttcctgcggttcgac
agcgacgccgcgattccgaggatggagccgcgagcgccgtgggtggagcaagaggggccg
cagtattgggagcggaccacagggtacgccaaggccaacgcacggactgaccgagtggcc
ctgaggaagctgctcctccgctacaaccagagcgaggccgggtctcacaccctccaggga
atgaacggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcacgcc
tacgacggcaaggattacatctccctgaacgaggacctgcgctcctggaccgccgcggac
acggtagctcggatcacccagcgcttctatgaggcagaggaatatgcagaggagttcagg
acctacctggagggcgagtgcctggagttgctccgcagatacctggagaacgggaaggag
acgctacagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgaccgt
gaggccaccctgaggtgctgggccctgggcttctaccctgccgagatcacactgacctgg
cagcgggacggggaggaacagacccaggacacggagcttgtggagaccaggcctgcaggg
gatggaaccttccagaagtgggcagctgtggtggtgccttccggagaggagcagagatac
acgtgccatgtgcaacacgaagggctgccccagcccctcaccctgagatgggagtcgtct
tctcagcccaccatccccattgtgggcatcgttgctggcctggctgtcctagcagttgtg
gttactggagctgtggtcgctgctgtaatgtggaggagaaagagctcagatagaaacaga
gggagctactctcagcctacaatgtga

KEGG   Macaca mulatta (rhesus monkey): 711532
Entry
711532            CDS       T01028                                 

Gene name
MAMU-E
Definition
(RefSeq) major histocompatibility complex, class I, E precursor
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    711532 (MAMU-E)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    711532 (MAMU-E)
   04145 Phagosome
    711532 (MAMU-E)
  09143 Cell growth and death
   04218 Cellular senescence
    711532 (MAMU-E)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    711532 (MAMU-E)
   04612 Antigen processing and presentation
    711532 (MAMU-E)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    711532 (MAMU-E)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    711532 (MAMU-E)
   05330 Allograft rejection
    711532 (MAMU-E)
   05332 Graft-versus-host disease
    711532 (MAMU-E)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    711532 (MAMU-E)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    711532 (MAMU-E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    711532 (MAMU-E)
   05170 Human immunodeficiency virus 1 infection
    711532 (MAMU-E)
   05168 Herpes simplex virus 1 infection
    711532 (MAMU-E)
   05163 Human cytomegalovirus infection
    711532 (MAMU-E)
   05167 Kaposi sarcoma-associated herpesvirus infection
    711532 (MAMU-E)
   05169 Epstein-Barr virus infection
    711532 (MAMU-E)
   05165 Human papillomavirus infection
    711532 (MAMU-E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    711532 (MAMU-E)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    711532 (MAMU-E)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   711532 (MAMU-E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  711532 (MAMU-E)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 MHC_I_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 711532
NCBI-ProteinID: NP_001108438
Ensembl: ENSMMUG00000039470
UniProt: Q5TM58
LinkDB
Position
4
AA seq 359 aa
MALRTLLLLLSALTKTWAGSHSLKYFHTSVSRPGRGGPRFISVGYVDDTQFVRYDSDAAS
PRMEPRAPWVEQEGPEYWDQETRSARDTAQTFRVNLETLRGYYNQSEAGSHTLQWMHGCD
LGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWSAVDTAAQISEQKSNDGSEAEHQRAYLED
TCVEWLHRYLENGKETLQRSEPPKTHVTHHPVSDHEATLRCWALGFYPAEITVTWQRDGE
DQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSPSTI
PIVGISAGLVLLGAVVTGAVVAAVMWRRKSSGRKGGSYSQASCSDSTQGSDESLTACKA
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcactacgaaccctacttctcctgctctcggcccttaccaagacctgggcgggctcc
cactccttgaagtatttccacacttccgtgtcccggcccggccgcggggggccccgcttc
atctccgtgggctacgtggacgacacccagttcgtgcggtatgacagcgacgccgcgagt
ccgaggatggagccgcgggcgccgtgggtggagcaggaggggccggagtattgggaccag
gagacacggagcgccagggacaccgcacagactttccgagtgaacctggagaccctgcgc
ggctactacaaccagagcgaggccgggtctcataccctccagtggatgcatggctgcgac
ctggggccggacgggcgcttcctccgcgggtatgaacagttcgcctacgacggcaaggat
tatctcaccctgaatgaggacctgcgctcctggtccgcggtggacacggcggctcaaatc
tccgagcaaaagtcaaatgatggctctgaggctgagcaccagagagcctacctggaagac
acatgcgtggagtggctccacagatacctggagaatgggaaggagacgctgcagcgctcg
gaacccccaaagacacacgtgacccaccaccccgtctctgatcatgaggccaccctgagg
tgctgggccctgggcttctatcctgcggagatcacagtgacctggcagcgggatggggag
gaccagacccaggacacggagcttgtggagaccaggcctgcaggggatggaactttccag
aagtgggcagctgtggtggtaccttctggagaggagcagagatacacgtgccatgtgcag
catgaggggctacccgagcccctcaccctgagatgggagccgtcttccccgtccaccatc
cccatcgtgggcatcagtgctggcctggttctccttggagctgtggtcactggagctgtg
gttgctgctgtgatgtggaggaggaagagctcaggtagaaaaggagggagctactctcag
gcttcgtgtagcgacagtacccagggatctgatgagtctctcacagcttgtaaagcctga

KEGG   Macaca mulatta (rhesus monkey): 711832
Entry
711832            CDS       T01028                                 

Gene name
MAMU-A
Definition
(RefSeq) major histocompatibility complex, class I, A isoform X1
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    711832 (MAMU-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    711832 (MAMU-A)
   04145 Phagosome
    711832 (MAMU-A)
  09143 Cell growth and death
   04218 Cellular senescence
    711832 (MAMU-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    711832 (MAMU-A)
   04612 Antigen processing and presentation
    711832 (MAMU-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    711832 (MAMU-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    711832 (MAMU-A)
   05330 Allograft rejection
    711832 (MAMU-A)
   05332 Graft-versus-host disease
    711832 (MAMU-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    711832 (MAMU-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    711832 (MAMU-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    711832 (MAMU-A)
   05170 Human immunodeficiency virus 1 infection
    711832 (MAMU-A)
   05168 Herpes simplex virus 1 infection
    711832 (MAMU-A)
   05163 Human cytomegalovirus infection
    711832 (MAMU-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    711832 (MAMU-A)
   05169 Epstein-Barr virus infection
    711832 (MAMU-A)
   05165 Human papillomavirus infection
    711832 (MAMU-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    711832 (MAMU-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    711832 (MAMU-A)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   711832 (MAMU-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  711832 (MAMU-A)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig LapA_dom Podoplanin
Other DBs
NCBI-GeneID: 711832
NCBI-ProteinID: XP_028702742
Ensembl: ENSMMUG00000044002
LinkDB
Position
4
AA seq 394 aa
MAVMAPRTLLLVLSGVLALTQTRAGSHSMSYFYTYMSRPGRGEPRFVAVGYVDDTQFVRF
DSDAASQRMEPRAPWVEQEGPEYWDRETRIMKTETQNAPVALRNLRGYYNQSEAGSHTYQ
VMYGCDLGPDGRLLRGYEQFAYDGKDYIALNDDLRSWTAADLAAQNTQRKWEAAGVAEQH
RTYLEGECLEWLRRYLENGKETLQRADPPKTHVTHHPVSDYEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGKEHRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIIAGLVLLGAVVTGAVVAVVMWRRKSSDRKGGSYSQAASSDSAQGSDVSL
TACKGEILGGLMCGGCWREQWTQLCCGVSLTWMY
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggcggtcatggcgccccgaaccctcctcctggtgctctcaggggtcctggccctgacc
cagacccgggcgggctcgcactccatgagctatttctacacctacatgtcccggcccggc
cgcggggagccccgcttcgtcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacacggatcatgaagaccgagacacagaatgccccagtg
gccctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacacctaccag
gtgatgtacggctgcgacctggggcccgacgggcgcctcctccgcgggtatgaacagttc
gcctacgacggcaaggattacatcgccctgaacgacgacctgcgttcctggacagccgcg
gacttggcggctcagaacacccagcggaagtgggaggcggcgggtgtggcggagcagcac
agaacctacctggagggcgagtgcctggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcggacccccccaagacacatgtgacccaccaccccgtctctgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggacggggaggaccaaactcaggacacggagcttgtggagaccaggcctgca
ggagatggaaccttccagaagtgggcggctgtggttgtgccttctggaaaagagcataga
tacacctgtcatgtgcagcatgagggtctgcccgagcccctcaccttgagatgggagccg
tcttcccagtccaccatccccatcgtgggcatcattgctggcctggttctgcttggagct
gtggtcactggagctgtggttgctgttgtgatgtggaggaggaagagctcagatagaaaa
ggagggagctactctcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acagcttgtaaaggtgagatcctggggggcctgatgtgtggggggtgttggagggaacag
tggacgcagctgtgctgtggggtttctttgacttggatgtattga

KEGG   Macaca mulatta (rhesus monkey): 714964
Entry
714964            CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: HLA class I histocompatibility antigen, B-67 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    714964
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    714964
   04145 Phagosome
    714964
  09143 Cell growth and death
   04218 Cellular senescence
    714964
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    714964
   04612 Antigen processing and presentation
    714964
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    714964
  09163 Immune disease
   05320 Autoimmune thyroid disease
    714964
   05330 Allograft rejection
    714964
   05332 Graft-versus-host disease
    714964
  09166 Cardiovascular disease
   05416 Viral myocarditis
    714964
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    714964
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    714964
   05170 Human immunodeficiency virus 1 infection
    714964
   05168 Herpes simplex virus 1 infection
    714964
   05163 Human cytomegalovirus infection
    714964
   05167 Kaposi sarcoma-associated herpesvirus infection
    714964
   05169 Epstein-Barr virus infection
    714964
   05165 Human papillomavirus infection
    714964
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    714964
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    714964
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   714964
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  714964
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Podoplanin Ig_2 Psg1
Other DBs
NCBI-GeneID: 714964
NCBI-ProteinID: XP_014985198
UniProt: B0Z9U9
LinkDB
Position
4
AA seq 392 aa
MSREANQRRRGLSSKLPTRPPGLRVSSDAEMRVVAPRTLLLLLSGALALTETWAGSHFLR
YFYTTVSRPGRGEPRFISVGYVDDTQFVRFDSDAESPREEPRAPWMEQEGPEYWEEQTGL
AKDITQSXRVGLGNLRGYYNQSEAGSHTIQTMYGCDLGPDGRLLRGCYQDAYDGRDYIAL
NEDLRSWTAADMAAQNTQRKWEAAGEAEQRRAYLEGECVESLRRYLENGKETLQRANPPK
THVTHHPVSNHEATLRCWALGFYPAEITLTWQRDGEDQTQDTXLVETRPAGDGTFQKWGA
VVVPSGKEQRYTCHVQHEGLREPLTLRWEPSSQSTIPIVGIVVGLAVLAIVVTGAVVAAV
MWRRKSSGGKGGSYSQAASSNSAQGSDVSLTA
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtctagagaagccaatcagcgtcgccgcggtctcagttctaaactccccacgcgccca
cccgggctcagagtctcctcagacgccgagatgcgggtcgtggcgccccgaaccctcctc
ctgctgctctcgggggccctggccctgaccgagacctgggccggctcgcacttcttgagg
tatttctacaccaccgtgtcccggcccggccgcggggagccccgcttcatctccgtgggc
tacgtggacgacacgcagttcgtgcggttcgacagcgacgccgagagtccgagagaggag
ccgcgggcgccgtggatggagcaggaggggccggagtattgggaagagcagacagggctc
gccaaggacatcacacagtcctaacgagtgggtctggggaacctgcgcggctactacaac
cagagcgaggcggggtctcacaccatccagacgatgtacggctgcgacctgggacccgac
gggcgcctcctccgcgggtgttaccaggacgcctacgacggcagggattacatcgccctg
aacgaggacctgcgctcctggaccgccgcggacatggcggctcagaacacccagcggaag
tgggaagcggccggtgaggcagagcagcggagagcctacctggagggcgagtgcgtggag
tcgcttcgcagatatctggagaacgggaaggagacgctgcagcgcgcgaatcccccaaag
acacacgtgacccaccaccccgtctctaaccatgaggccaccctgaggtgctgggccctg
ggcttctaccctgcggagatcacactgacctggcagcgggatggggaggaccaaactcag
gacacanngcttgtggagaccaggccagcaggagatggaaccttccagaagtggggagct
gtggttgtgccttctggaaaagagcagagatacacgtgccatgtgcagcatgaggggctg
cgggagcccctcaccctgagatgggagccatcttcccagtccaccatccccatcgtgggc
attgttgttggcctggctgtcctagcaattgtggtcactggagctgtggtcgctgctgtg
atgtggaggaggaagagctcaggtggaaaaggagggagctactctcaggctgcgtccagc
aacagtgcccagggatctgatgtgtctctcacggcttga

KEGG   Macaca mulatta (rhesus monkey): 719250
Entry
719250            CDS       T01028                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-14 alpha chain isoform X7
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    719250
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    719250
   04145 Phagosome
    719250
  09143 Cell growth and death
   04218 Cellular senescence
    719250
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    719250
   04612 Antigen processing and presentation
    719250
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    719250
  09163 Immune disease
   05320 Autoimmune thyroid disease
    719250
   05330 Allograft rejection
    719250
   05332 Graft-versus-host disease
    719250
  09166 Cardiovascular disease
   05416 Viral myocarditis
    719250
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    719250
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    719250
   05170 Human immunodeficiency virus 1 infection
    719250
   05168 Herpes simplex virus 1 infection
    719250
   05163 Human cytomegalovirus infection
    719250
   05167 Kaposi sarcoma-associated herpesvirus infection
    719250
   05169 Epstein-Barr virus infection
    719250
   05165 Human papillomavirus infection
    719250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    719250
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    719250
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   719250
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  719250
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig MHC_I_C
Other DBs
NCBI-GeneID: 719250
NCBI-ProteinID: XP_014984760
LinkDB
Position
4
AA seq 346 aa
MVPRTLLLLLSGALALTETWVGSHSLRYFSTAVSRPGRGEPWYLEVGYVDDTQFVRFDSD
AASPRMEPRAPWMEQEGPEYWDRNTRNAKVNAETFRGDLRNLLRYYNQSEAGSHTFQWMY
GCDLGPDGRLLRGYRQFAYDGRDYIALNEDLRSWTAADTTAQITQRKWEAARAAEKLRAY
LEGECLEWLRRYLENGKETLQHADPPKTHVAHHPVSDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHKGLLEPLTLRWEPSSQ
STIPIVGIVAGLAVLGAVVAAVMWKRKSLGSNSAQSSYVSLMDSKG
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggtgccccgaaccctcctcctgctgctctcgggggccctggccctgaccgagacctgg
gtgggctcccactccttgaggtatttcagcaccgctgtctcccggcccggccgcggggag
ccctggtacctcgaagtcggctacgtggacgacacgcagttcgtgcggttcgacagcgac
gcggcgagtccgaggatggagccgcgggcgccgtggatggagcaggaggggccggagtat
tgggaccggaacacacggaacgccaaggtcaacgcagagactttccgaggggacttgagg
aacctgctccgctactacaaccagagcgaggcagggtctcacaccttccagtggatgtac
ggctgcgaccttgggcccgacgggcgcctcctccgcgggtaccggcagttcgcctacgac
ggcagggattacatcgccctgaacgaggacctgcgctcctggaccgccgcagacacgacg
gctcagataacgcagcgcaagtgggaggcggcccgtgcggcggagaagctgagagcctac
ttggagggcgagtgcctggagtggctccgtagatacctggagaacgggaaggagacgctg
cagcacgcggatcccccaaagacacatgtggcccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggagcaaactcaggacactgagcttgtggagaccaggccagcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaagagcagagatacacgtgc
catgtgcagcacaaggggctgctggagcccctcaccttgagatgggagccgtcttcccaa
tccaccatccccatcgtgggcatcgttgctggcctggctgtcctaggagctgtggttgct
gctgtgatgtggaagaggaagagcttaggtagcaacagtgcccagagctcttatgtgtct
ctcatggattctaaaggctga

KEGG   Macaca mulatta (rhesus monkey): 719702
Entry
719702            CDS       T01028                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-46 alpha chain-like precursor
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    719702
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    719702
   04145 Phagosome
    719702
  09143 Cell growth and death
   04218 Cellular senescence
    719702
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    719702
   04612 Antigen processing and presentation
    719702
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    719702
  09163 Immune disease
   05320 Autoimmune thyroid disease
    719702
   05330 Allograft rejection
    719702
   05332 Graft-versus-host disease
    719702
  09166 Cardiovascular disease
   05416 Viral myocarditis
    719702
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    719702
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    719702
   05170 Human immunodeficiency virus 1 infection
    719702
   05168 Herpes simplex virus 1 infection
    719702
   05163 Human cytomegalovirus infection
    719702
   05167 Kaposi sarcoma-associated herpesvirus infection
    719702
   05169 Epstein-Barr virus infection
    719702
   05165 Human papillomavirus infection
    719702
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    719702
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    719702
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   719702
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  719702
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 719702
NCBI-ProteinID: NP_001305276
UniProt: K4MU36
LinkDB
Structure
PDB: 
4ZFZ

AA seq 362 aa
MRVMAPRTLLLLLSAALALTQTWAGSHSLRYFRAAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPKKEPRAPWMEQEGPEYWEEQTRRVKAAAQTFRVNLGNLRGYYNQSEAGSHTLQ
TMSGCDLGPDGRLLRGYYQQAYDGRDYIALNEDLRSWTAADEAAQNTQRKWEAAGVAEQW
RAYLEGECLECLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLT
WQRDGEEQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEP
SSQSTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQTASSDSAQGSDVSL
AA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgaaccctcctcctgctgctctcggcggccctggccctgacc
cagacctgggccggctcccactccttgaggtatttccgcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatctccgtgggctacgtggacgacacgcagttcgtgcggttt
gacagcgacgccgcgagtccgaaaaaggagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggaagagcagacacggagagtcaaggccgccgcacagactttccgagtg
aacctggggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
acaatgtctggctgcgacctggggcccgacgggcgcctcctccgcgggtattaccagcaa
gcctacgacggcagggattacatcgccctgaacgaggacctgcgctcctggaccgctgcg
gatgaggcggctcagaacacccagcgcaagtgggaggcggccggtgtggcagagcagtgg
agagcctacctggagggagagtgcctggagtgtctccgcagatacctggagaacgggaag
gagactctgcagcgcgcggatcccccaaagacacacgtgacccaccaccccgtctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggagcaaactcaggacaccgagcttgtggagaccaggccagga
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcaccctgagatgggagcca
tcttcccagtccaccatccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcaccggagctgtggttgctgctgtgatgtggaggaggaagagctcaggtggaaaa
ggagggagctactctcagactgcgtccagcgacagtgcccagggctctgatgtgtctctc
gcggcttga

KEGG   Macaca mulatta (rhesus monkey): 723473
Entry
723473            CDS       T01028                                 

Definition
(RefSeq) patr class I histocompatibility antigen, B-1 alpha chain-like precursor
  KO
K06751  MHC class I antigen
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04144  Endocytosis
mcc04145  Phagosome
mcc04218  Cellular senescence
mcc04514  Cell adhesion molecules
mcc04612  Antigen processing and presentation
mcc04940  Type I diabetes mellitus
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05203  Viral carcinogenesis
mcc05320  Autoimmune thyroid disease
mcc05330  Allograft rejection
mcc05332  Graft-versus-host disease
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    723473
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    723473
   04145 Phagosome
    723473
  09143 Cell growth and death
   04218 Cellular senescence
    723473
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    723473
   04612 Antigen processing and presentation
    723473
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    723473
  09163 Immune disease
   05320 Autoimmune thyroid disease
    723473
   05330 Allograft rejection
    723473
   05332 Graft-versus-host disease
    723473
  09166 Cardiovascular disease
   05416 Viral myocarditis
    723473
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    723473
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    723473
   05170 Human immunodeficiency virus 1 infection
    723473
   05168 Herpes simplex virus 1 infection
    723473
   05163 Human cytomegalovirus infection
    723473
   05167 Kaposi sarcoma-associated herpesvirus infection
    723473
   05169 Epstein-Barr virus infection
    723473
   05165 Human papillomavirus infection
    723473
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    723473
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    723473
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   723473
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Antigens
  723473
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Trp_oprn_chp
Other DBs
NCBI-GeneID: 723473
NCBI-ProteinID: NP_001305272
Ensembl: ENSMMUG00000044709
UniProt: B8YLX0
LinkDB
AA seq 362 aa
MAPRALLLLLSGALALTETWAGSHSMRYFHTAVSRPGRGEPRFISVGYVDDTQFVRFDSN
AASPRMEPRAPWIEQEGPEYWDRETQKAKAHAQVFRVNLRTALRYYNQSEAGSHTFQRMH
GCDLGPDGRLLRGYHQLAYDGKDYIALNGDLSSWSAADMAAQVTQRKWEAAREAEQRRAY
LEGECLESLRRYLENGKETLQRVDPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYMCHVQHQGLLEPLTLRWERASQ
PSIPIVGIVAGLAVLGTVVAVAVVAAVMRKTESSGGKSGSYWSSSAQGSDQDSDESLMAC
KA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcgcctcgagccctcctcctgctgctctcgggggccctggccctgaccgagacctgg
gccggctcccactccatgaggtatttccacaccgccgtgtcccggcccggccgcggggag
ccccgcttcatctccgtgggttacgtggatgacacgcagttcgtgcggttcgacagcaac
gccgcgagtccgaggatggagccgcgggcgccgtggatagagcaggaggggccggagtat
tgggaccgggagacacagaaagccaaggcccacgcacaggttttccgagtgaacctgcgc
accgcgcttcgctactacaaccagagcgaggccgggtctcacaccttccagaggatgcat
ggctgcgacctggggcctgacgggcgcctcctccgcgggtatcaccagttagcctatgat
ggcaaggattacatcgccctgaacggggacctgagctcctggagcgccgcggatatggcg
gctcaggtcacacagcgcaagtgggaggcggcccgtgaagctgagcagcggagagcctac
ctggagggcgagtgcctggagtcgctccgcagatacctggagaacgggaaggagacgctg
cagcgcgtggatcccccaaaaacacacgtgacccaccaccccgtctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcgg
gatggggaggagcaaactcaggacactgagcttgtggagaccaggccagcaggggacaga
accttccagaaatgggcagctgtggtggtaccttctggagaagagcagagatacatgtgc
catgtgcagcaccaggggctgctggagcccctcaccctgagatgggaacgggcttcccag
ccctccatccccatcgtgggcatcgttgctggcctggctgtcttaggaactgtggtcgcc
gtagctgtggttgctgctgtgatgcggaagacagagagctcaggtggaaaaagcgggagc
tactggagcagcagtgcccagggctctgatcaggactctgatgagtctctcatggcctgt
aaagcctga

DBGET integrated database retrieval system