KEGG   Macaca mulatta (rhesus monkey): 100423877
Entry
100423877         CDS       T01028                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1 precursor
  KO
K05132  interferon gamma receptor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04066  HIF-1 signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05164  Influenza A
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05200  Pathways in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100423877 (IFNGR1)
   04066 HIF-1 signaling pathway
    100423877 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100423877 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100423877 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100423877 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    100423877 (IFNGR1)
   04659 Th17 cell differentiation
    100423877 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100423877 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100423877 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100423877 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100423877 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100423877 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    100423877 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    100423877 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100423877 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100423877 (IFNGR1)
   05140 Leishmaniasis
    100423877 (IFNGR1)
   05142 Chagas disease
    100423877 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    100423877 (IFNGR1)
   04090 CD molecules [BR:mcc04090]
    100423877 (IFNGR1)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IFN receptor family
   100423877 (IFNGR1)
CD molecules [BR:mcc04090]
 Proteins
  100423877 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100423877
NCBI-ProteinID: NP_001253229
Ensembl: ENSMMUG00000045195
UniProt: F7HB25 H9FTY7
LinkDB
Position
4
AA seq 488 aa
MALLFLLPLVMQSVSRAEMGTADLGPSSVPIPTNVTIESYNMNTIVYWEYQNMPQDPVFT
VEVKNYGVKNAEWIDACISISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSKEFA
VCRDGKIGPPKLDIRKEEKQIIIDVFHPSVFVNGEEQEVDYDPETTCYIKVYNVYVRMNG
SEIQYKILTQKEDDCDEIQCQLVIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFN
SSIKGSLWIPVVAALLLFLVLSLVLICFYIKKINPLKEKSIILPKSLISVVRSATLETKP
ESKYVSLITSYQPCSLEKEVVCEEPLSPATVPGMHTEDNPGKVEHTEELSSITEVVTTEE
NIPDMAPGSHLTPIERESSSPLSSNQSEPCSVALNSYHSRNCSDSDHSRNGFDTDSSCLE
SHNSSDSEFPPNNKGEIKTEGQELITVIKAPTSFGYDKPHVLVDLLVDDGRKESLIGYRP
TEGSKEFS
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggctctcctctttcttctgccccttgtcatgcagagtgtgagcagggctgagatgggc
accgcggatctggggccgtcctcagtgcctataccaactaatgttacaattgagtcctat
aacatgaacaccatcgtatattgggagtaccagaacatgccacaggaccctgtttttacc
gtagaggtaaagaactatggtgttaagaatgcagaatggattgatgcctgcatcagtatt
tctcatcattattgtaatatttctgatcacgttggtgatccatcaaattctctttgggtc
agagttaaagccagggttggacaaaaagaatctgcctatgcaaagtcaaaagaatttgct
gtgtgccgagatggaaaaattggaccacctaaactggatatcagaaaggaggagaagcaa
atcatcattgacgtatttcacccttcagtttttgtaaatggagaagagcaggaagtcgat
tatgatccagaaactacctgttacattaaggtgtacaatgtgtatgtgagaatgaacgga
agtgagatccagtataaaatactgacgcagaaggaagatgattgtgacgagattcagtgc
cagttagtgattccagtgtcctcactgaattctcagtactgtgtttcagcagaaggagtc
ttacatgtatggggtgttacaactgaaaagtcaaaagaagtttgtattaccattttcaat
agcagcataaaaggttctctttggattccagttgttgctgctttactactctttctagta
cttagcctggtattgatctgtttttatattaagaagattaatccattgaaggaaaaaagc
ataatattacccaagtccttgatctctgtggtaagaagtgctactttagagacaaaacct
gaatcaaaatatgtatcactcatcacatcataccagccatgttccttagaaaaggaggtg
gtctgtgaagaaccgttgtctccagcaacagttccaggcatgcataccgaagacaatcca
ggaaaagtagagcatacagaagaactttctagtataacagaagtggtgactactgaagaa
aacattcctgacatggccccgggcagccatctgactccaatagagagagagagttcttca
cctttaagtagtaaccagtctgaaccctgcagcgtcgctttaaactcctatcactccaga
aattgttctgatagtgatcactccagaaatggttttgatactgattccagctgtctggaa
tcacataactcatctgattcagaatttcccccaaataataaaggtgaaataaaaacagaa
ggacaagagctcataacagtaataaaagcccccacctcctttggttatgataaaccgcat
gtgctggtggatctacttgtggatgatggccgtaaagagtccttgattggttacagacca
acagaaggttccaaagaattttcatga

KEGG   Macaca mulatta (rhesus monkey): 106995138
Entry
106995138         CDS       T01028                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha isoform X1
  KO
K04737  interleukin 3 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106995138 (IL3RA)
   04151 PI3K-Akt signaling pathway
    106995138 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106995138 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106995138 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106995138 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106995138 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    106995138 (IL3RA)
   04090 CD molecules [BR:mcc04090]
    106995138 (IL3RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   106995138 (IL3RA)
CD molecules [BR:mcc04090]
 Proteins
  106995138 (IL3RA)
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind Gemini_mov CRAM_rpt
Other DBs
NCBI-GeneID: 106995138
NCBI-ProteinID: XP_028698793
LinkDB
Position
Unknown
AA seq 378 aa
MTLLWLTLLLVATPCLLQTKEDPKAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSM
PAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFL
SCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIARLSRGSQSS
HILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYEL
RIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGAS
SRAWRTSLLIALGTLLALLCVFLLCRRYLVMQRLFPRIPHMKDPIGDTFQQDKLVVWEAG
KAGLEECLVSEVQVVEKT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgaccctcctttggctgacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatccaaaggcaccaatcaggaatctaaggatgaaagaaaaggctcagcagttgatg
tgggacctgaacagaaacgtgaccgacgtggagtgtatcaaaggcaccgactattctatg
ccggcaatgaacaacagctattgccagttcggagccatttccttatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacgcctcgggcaggcgcggagaatctgacctgctgggttcatgacgtggatttcttg
agctgcagctgggtggtaggcccggcggcccccgctgacgtccagtacgacctgtacttg
aacaatcccaacagccacgaacagtacaggtgccttcactacaaaacggatgctcgggga
acacagatcgggtgtcggttcgatgacatcgctcgactctcccgcggttctcaaagttcc
cacatcctggtgaggggcaggagcgcagccgtcagtatcccctgcacagataagtttgtc
ttcttttcacagattgagagattaactccacccaacatgactggagagtgtaatgagaca
cattccttcatgcactggaaaatgaaaagtcatttcaatcgcaaattccgctatgagctt
cggatccaaaagagaatgcagcctgtaaggacagaacaggtcagagacacaacctccttc
cagctacccaatcctggaacgtacacagtgcaaataagagcccgggaaacagtgtatgaa
ttcttgagtgcctggagcaccccccagcgcttcgagtgcgaccaggaggagggcgcgagc
tcgcgtgcctggcggacgtcgctgctgatcgcgctggggacgctgctggccttgctctgt
gtgttcctcctctgcagaaggtatctggtgatgcagaggctgtttccccgcatcccacac
atgaaagaccccatcggtgacaccttccaacaggacaagctggtggtctgggaggcgggc
aaagccggcctggaggagtgtctggtgtctgaagtgcaggtggtggagaaaacttga

KEGG   Macaca mulatta (rhesus monkey): 106995742
Entry
106995742         CDS       T01028                                 

Gene name
CRLF2
Definition
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106995742 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106995742 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    106995742 (CRLF2)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   106995742 (CRLF2)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac
Other DBs
NCBI-GeneID: 106995742
NCBI-ProteinID: XP_028697803
Ensembl: ENSMMUG00000047385
LinkDB
Position
X
AA seq 394 aa
MSHERSASGRFLRTSLSTPVSGMGRLVLLWGAAVFLLGSWMALGQVATGEGLQIQIIYFN
LETVQVTWNASHYPRSNLSFHYKFSRDEAYDQCTVYILQEGHTSGCLLDAEQQDDILYFS
IRNGTHPVFTASRWIFYYLKPSSPKQVSFSWHQDAVTLTCSDLSYRGLLYEVQYRSPFDT
EWQSKQENTCNVTIEDLDAEKCYAFRARVKAMEDAYGPDTYPSDWSEVTCWQRGETRDSC
PEPRTPPKPKLSKFMLVSSLAILLMVCLLLLSLRKLWRVKKFLMPSVPDPKSTFPGLFEI
HQGNFQEWITDTQNVAHLHKIAGAEPEGGPEESLVVQLAKTEAESPRTPDPQTEDGKASG
GSLLLPHQPPLQGGDVVTLGGFTFVMNDSSYVAL
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgagtcatgagcgatctgctagtggcaggttcctgaggacctcactctccactcctgtt
tcaggcatgggacggttggttctgctgtggggagctgctgtctttctgctgggaagctgg
atggctttggggcaagtagcaacaggagaaggactacagattcagatcatctactttaat
ctagaaacggtgcaggtgacatggaatgccagccactaccccaggagtaacctgagtttc
cactacaaattcagtcgagatgaggcctatgaccagtgcaccgtctacattctccaggaa
ggtcacacctcggggtgcctcctagacgcagagcagcaagacgatattctgtatttctcc
atcaggaacgggacgcaccccgttttcaccgccagtcgctggatcttttattacctgaag
cccagttctccgaagcaggtgagcttttcgtggcatcaggatgcggtgacactgacgtgt
tctgacctgtcctacaggggtctcctctatgaggttcagtaccggagccccttcgacacg
gagtggcagtccaaacaggaaaatacctgcaatgtcactatagaagacttggatgccgag
aagtgttatgctttccgggcccgggtgaaggccatggaggatgcgtatgggccggacacg
tacccgagcgactggtcagaggtgacgtgctggcagagaggcgagactcgcgattcgtgc
ccagagcctcgcacgcctcccaaaccgaagctgtccaaatttatgttagtttccagcctg
gccatccttctgatggtgtgtcttctccttctgtctttacggaaattatggagagtgaag
aaatttctcatgcccagcgtgccagacccgaaatccaccttccctgggctctttgagata
caccaagggaacttccaggagtggatcacagacacccagaacgtggcccacctccacaag
atagcaggtgcagagccagaaggtggccctgaggagtctctggtggtccagttggccaag
acggaagccgagtcacccaggacgccggacccacagaccgaggacggaaaggcctctggg
ggatccctcctgcttccccaccagccgcccctgcaaggcggtgatgtggtcactcttggg
ggctttacctttgtgatgaatgacagctcgtatgtggcgttatga

KEGG   Macaca mulatta (rhesus monkey): 114675718
Entry
114675718         CDS       T01028                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha-like
  KO
K04737  interleukin 3 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114675718
   04151 PI3K-Akt signaling pathway
    114675718
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    114675718
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    114675718
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    114675718
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114675718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    114675718
   04090 CD molecules [BR:mcc04090]
    114675718
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   114675718
CD molecules [BR:mcc04090]
 Proteins
  114675718
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N EpoR_lig-bind CRAM_rpt
Other DBs
NCBI-GeneID: 114675718
NCBI-ProteinID: XP_028698699
LinkDB
Position
Unknown
AA seq 257 aa
MTLLWLTLLLVATPCLLQTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSM
PAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPQAGAENLTCWVHDVDFL
SCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYTTDARGTQIGCRFDDIARLSRGSQSS
HILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYEL
RIQKRMQPVRTEQVSVA
NT seq 774 nt   +upstreamnt  +downstreamnt
atgaccctcctttggctgacgctgctcctggtcgccacgccctgtctcctgcaaaccaag
gaggatccaaatgcaccaatcaggaatctaaggatgaaagaaaaggctcagcagttgatg
tgggacctgaacagaaacgtgaccgacgtggagtgtatcaaaggcaccgactattctatg
ccggcaatgaacaacagctattgccagttcggagccatttccttatgtgaagtgaccaac
tacaccgtccgagtggccagtcccccgttctccacgtggatcctcttccctgagaacagt
gggacgcctcaggcaggcgcggagaatctgacctgctgggttcatgacgtggatttcttg
agctgcagctgggtggtaggcccggcggcccccgctgacgtccagtacgacctgtacttg
aacaatcccaacagccacgaacagtacaggtgccttcactacacaacggatgctcgggga
acacagatcgggtgtcggttcgatgacatcgctcgactctcccgcggttctcaaagttcc
cacatcctggtgaggggcaggagcgcagccgtcagtatcccctgcacagataagtttgtc
ttcttttcacagattgagagattaactccacccaacatgactggagagtgtaatgagaca
cattccttcatgcactggaaaatgaaaagtcatttcaatcgcaaattccgctatgagctt
cggatccaaaagagaatgcagcctgtaaggacagaacaggtgagtgttgcgtag

KEGG   Macaca mulatta (rhesus monkey): 574126
Entry
574126            CDS       T01028                                 

Gene name
LEPR
Definition
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04152  AMPK signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574126 (LEPR)
   04152 AMPK signaling pathway
    574126 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    574126 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    574126 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    574126 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    574126 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574126 (LEPR)
   04090 CD molecules [BR:mcc04090]
    574126 (LEPR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  Prolactin receptor family
   574126 (LEPR)
CD molecules [BR:mcc04090]
 Proteins
  574126 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 574126
NCBI-ProteinID: NP_001027991
Ensembl: ENSMMUG00000003265
UniProt: Q9MYL0
LinkDB
Position
1
AA seq 1194 aa
MICQKFCVVLLHWEFICVITAFNLSYPITPWRFKLSCMPPNSTYDYFLLPAGLSKNTSNL
NGHYETAVEFNSSDTHFSNLSKTTFHCCFRSEQDRNCSLCADNIEGKTFVSTVNSSVFQQ
MGANWNIQCWLKGDLKLFICYVESLFKNPFKNYKHKVHLLYVLPEVLEDSPLVPQKGSFQ
MVHCNCSVHERCECLVPVPTAKLNDTLLMCLKITSGGVIFQSPLMSVQPINMVKPDPPLG
LRMEITDDGNLKISWSSPPLVPFPLQYEVKYSENSTTVIREADKIVSATSLLVDGILPGS
SYEVQVRGKRLDGPGIWSDWSTPHVFTTQDVIYFPPKILTSVGSNVSFHCIYKNENKIVS
SKKIVWWMNLAEKIPQSQYDVVSDHVSKVTFFNLNETKPRGKFTYDAVYCCNEHECHHRY
AELYVIDVNINISCETDGHLTKMTCRWSTNTIQSLAGSTLQLRYRRSSLYCFDIPSIHPI
SKPKDCYLQSDGFYECVFQPIFLLSGYTMWIRINHPLGSLDSPPTCVLPDSVVKPLPPSS
VKAEIIKNIGLLKISWEKPVFPENNLQFQIRYGLSGKEIQWKMYDVYDAKSKSVSLPVPD
FCAVYAVQVRCKRSDGLGLWSNWSNPAYTVVMDIKVPMRGPEFWRIINGDTMKKEKNVTL
LWKPLMKNESLCSVQRYVINHHTSCNGTWSEDVGNHTKFTFLWTEQAHTVTVLAINSIGA
SVANFNLTFSWPMSKVNIVQSLSAYPLNSSCVILSWILSPSDYKLMYFIIEWKNLNEDGE
IKWLRISSSVKKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFAQDNTEKHQNDAGL
YVIVPVIISSSILLLGTLLILHQRMKKLFWEDVPNPKNCSWAQGLNFQKIRGFVMLPRLV
LNSQAQVIHPPRPPKVLELQPETFEHLFIKHTASVTCGPLLLEPETISEDISVDTSWKNK
DEMVPTTVVSLLSTTDLEKGSVCISDQFNSVNFSEAEGTEVTCEDESQRQPFVKYATLIS
NSKPSETDEEQGLINSSVTKCFSSKNSPLKDSFSNSSWEIEAQAFFILSDQRPNIILPHL
TFSEGLDELLRLEGNFPEENNDEKSIYYLGVTSIKKRESGVLLTDKSRVLCPFPAPCLFT
DIRVLQDSCSHFVENNFNLGTSSKKTFASYMPQFQTCSTQTHKIMENKMCDLTV
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgatttgtcaaaaattctgtgtggttttgttacattgggagtttatttgtgtgataact
gcatttaacttgtcatatccaattactccttggagatttaagttgtcttgcatgccacca
aattcaacctatgactacttccttttgcctgctggactctcaaagaatacttcaaatttg
aatggacattatgagacagctgttgagtttaattcaagtgatactcacttttctaactta
tccaaaacaactttccactgttgctttcggagtgagcaagatagaaactgctctttgtgt
gcagacaacattgaaggaaagacatttgtttcaacagtaaattcttcagtttttcaacaa
atgggtgcaaactggaacatacagtgctggctaaaaggagacttgaaattattcatctgt
tatgtggagtcattatttaagaatccattcaagaattacaaacataaggtccatctttta
tatgttctgccggaagtgttagaagattcacctctggttccccaaaaaggcagttttcag
atggttcattgcaattgcagtgttcatgaacgttgtgaatgtcttgtgcctgtgccaaca
gccaaactcaacgacactctccttatgtgtttgaaaatcacatctggtggagtaattttc
cagtcacctctaatgtcagttcagcccataaatatggtgaagcctgatccaccattaggt
ttgcgtatggaaatcacagatgatggtaatttaaagatttcttggtccagcccaccattg
gtaccatttccacttcaatatgaagtgaaatattcagagaattctacaacagttatcaga
gaagctgacaagattgtctcagctacatccctgctggtagacggtatacttcctgggtct
tcatatgaggttcaggtgaggggcaagagactggatggcccaggaatctggagtgactgg
agtactcctcatgtctttaccacacaagatgtcatatactttccacctaaaattctgaca
agtgttggatctaatgtttcttttcactgcatctataagaatgaaaacaagattgtttcc
tcaaaaaagattgtttggtggatgaatttagctgagaaaatccctcaaagccagtatgat
gttgtgagtgatcatgttagcaaagttacttttttcaatctgaatgaaaccaaacctcga
ggaaagtttacctatgatgcagtgtactgctgcaatgaacatgaatgccatcatcgctat
gctgaattatatgtgattgatgtcaatatcaatatctcatgtgaaactgatgggcactta
actaaaatgacttgcagatggtcaaccaatacaatccagtcacttgcgggaagcactttg
caattgaggtatcgtaggagcagcctttactgttttgatattccatctattcatcccata
tctaagcctaaagattgctatttgcagagcgatggtttttatgaatgcgttttccagcca
atctttctattatctggctatacaatgtggattaggatcaatcaccctctaggttcactt
gactctccaccgacatgtgtccttcctgattctgtggtgaagccactgcctccatccagt
gtgaaagcagaaattattaaaaacattggattattgaaaatatcttgggaaaagccagtc
tttccagagaataaccttcaattccagattcgctatggtttgagtggaaaagaaatacaa
tggaagatgtatgatgtttatgatgcaaaatcaaaatctgtcagtctcccagttccagac
ttctgtgcagtttatgctgttcaggtgcgctgtaagaggtcagatggattgggactttgg
agtaattggagcaatccagcctacacagttgtcatggatataaaagttcctatgagagga
cctgagttttggagaataattaatggagatactatgaaaaaggagaaaaatgtgacttta
ctttggaagcccctgatgaaaaatgaatcattgtgcagtgttcagagatatgtgataaac
catcatacttcctgcaatggaacatggtcagaagatgtgggaaatcacactaaattcact
ttcctgtggacagagcaagcacacactgttacggttctggccatcaattcaattggtgct
tctgttgcaaattttaatttaaccttttcatggcctatgagcaaagtaaatatcgtgcag
tcactcagtgcttatcctttaaacagcagttgtgtgattctttcctggatactatcaccc
agtgattacaagctaatgtattttattattgagtggaaaaatcttaatgaagatggagaa
ataaaatggcttagaatctcttcatctgttaagaagtattatatccatgatcattttatc
cccattgagaagtaccagttcagtctttacccaatatttatggaaggagtgggaaaacca
aagataattaatagtttcgctcaagataatactgaaaaacaccagaatgatgcaggttta
tatgtgattgtgccagtaattatttcctcttccatcttattgcttggaacattattaata
ttgcaccaaagaatgaaaaaactgttttgggaagatgttccaaaccccaagaattgttcc
tgggcgcaaggacttaattttcagaagatacggggttttgtcatgttgcccaggctggtc
ttgaactcccaggctcaagtgatccacccacctcggcctcccaaagtgctggaattacag
ccagaaacgtttgagcatctttttatcaagcatacagcatcagtgacatgtggtcctctt
cttttggagcctgaaacaatttcagaagatatcagtgttgatacatcatggaaaaataaa
gatgagatggtgccaacaactgtggtctctctactttcaacaacagatcttgaaaagggt
tctgtttgtattagtgaccagttcaacagtgttaacttctctgaggctgagggtaccgag
gtaacctgtgaggatgaaagccagagacaaccctttgttaaatatgccacgctgatcagc
aactctaaaccaagtgaaactgatgaagaacaagggcttataaatagttcagttaccaag
tgcttctctagcaaaaattctccattgaaggattctttctctaatagctcatgggagata
gaggcccaggcattttttatattatcagatcagcgtcccaacataattttaccacacctc
acattctcagaaggattggatgaacttttgagactggagggaaatttccctgaagaaaat
aatgatgaaaagtctatctattatttaggggtcacctcaatcaaaaagagagagagtggt
gtgcttttgactgacaagtcaagggtattgtgcccattcccagccccctgtttattcacg
gacatcagagttctccaggacagttgctcacactttgtagaaaataatttcaacttagga
acttctagtaagaagacttttgcatcttacatgcctcaattccaaacttgctctactcag
actcataagatcatggaaaacaagatgtgtgacctaactgtgtaa

KEGG   Macaca mulatta (rhesus monkey): 574127
Entry
574127            CDS       T01028                                 

Gene name
IL6ST
Definition
(RefSeq) interleukin-6 receptor subunit beta precursor
  KO
K05060  interleukin 6 signal transducer
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574127 (IL6ST)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574127 (IL6ST)
   04061 Viral protein interaction with cytokine and cytokine receptor
    574127 (IL6ST)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    574127 (IL6ST)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    574127 (IL6ST)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574127 (IL6ST)
   05203 Viral carcinogenesis
    574127 (IL6ST)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    574127 (IL6ST)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574127 (IL6ST)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574127 (IL6ST)
   04090 CD molecules [BR:mcc04090]
    574127 (IL6ST)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   574127 (IL6ST)
CD molecules [BR:mcc04090]
 Proteins
  574127 (IL6ST)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 IL6Ra-bind EpoR_lig-bind Pur_ac_phosph_N fn3_2 ObR_Ig DCP1
Other DBs
NCBI-GeneID: 574127
NCBI-ProteinID: NP_001252920
Ensembl: ENSMMUG00000001893
UniProt: G7MTS1 A0A5F8A6Y8
LinkDB
Position
6
AA seq 918 aa
MLTLQTWVVQALFIFLTTESIGELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHV
NANYIVWKTNHFTIPKEQYTIINRTASSVTFTDISSLNIQLTCNILTFGQLEQNVYGITI
ISGLPPEKPKNLSCIVNEGKKMRCEWNRGRETHLETNFTLKSEWATHKFADCKAKRDTPT
SCTVDYSTVYFVNIEVWVEAENALGKVTSDHINFDPVYKVKPNPPHNLSVINSEELSSIL
KLTWTNPSIKSVIRLKYNIQYRTKDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIC
CMKEDGKGYWSDWSEEANGITYEDRPSKAPSFWYKIDPSHAQGYRTVQLMWKTLPPFEAN
GKILDYEVTLTRWKSHLQNYTVNDTKLTVNLTNDRYVATLTARNLVGKSDAAVLTIPACD
FQATHPVMDLKAFPKDNMLWVEWTTPRESVKKYILEWCVLSDKAPCIADWQQEDGTVHRT
HLRGNLAESKCYLITVTPVYADGPGSPESIKAYLKQAPPSKGPTVRTKKVGKNEAVLEWD
QLPVDVQNGFIRNYTIFYRTIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEGG
KDGPEFTFTTPKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKRDLIKKHIWPNVPDPSK
SHIAQWSPHTPPRHNFSSKDQMYSDGNFTDVSVVEIEANDKKPFPEDLKSLDLFKKEKIN
TEGHSSGIGGSSCMSSSRPSISSSDENESSQNTSSTVQYSTVVHSGYRHQVPSVQVFSRS
ESTQPLLDSEERPEDLQLVDHVDGSDDILPRQQYFKQNCSQHESSPDISHFERSKQVSSV
NEEDFVRLKQQISDHISQSCGSGEMKMFQEVSAADPFGPGTEGQVERFETIGMEAAIDEG
MPKSYLPQTVRQGGYMPQ
NT seq 2757 nt   +upstreamnt  +downstreamnt
atgttgacgttgcagacttgggtagtgcaagccttgtttatttttctcaccactgaatca
ataggtgaacttctagatccatgtggttatatcagtcctgaatctccagttgtacaactt
cattctaatttcactgcagtttgtgtgctaaaggaaaaatgtatggattattttcatgta
aatgctaattacattgtctggaaaacaaaccattttactattcctaaggagcaatatact
atcataaacagaacagcctccagtgtcacctttacagatatatcttcattaaatattcag
ctcacttgcaacatccttacatttggacagcttgaacagaatgtttatggaatcacaata
atttcaggcttgcctccagaaaaacctaaaaatttgagttgcattgtgaatgagggaaag
aaaatgaggtgtgagtggaatcgtggaagggaaacacacttggagacaaacttcacttta
aaatctgaatgggcaacacacaagtttgctgattgcaaagcaaaacgtgacacccccacc
tcatgcactgttgattattctactgtgtattttgtcaacattgaagtctgggtagaagca
gagaatgcccttgggaaggttacatcagatcatatcaattttgatcctgtatataaagtg
aagcccaatccgccacataatttatcagtgatcaactcagaggaactgtctagtatctta
aaattgacatggaccaacccaagtattaagagtgttataagactaaaatataacattcaa
tataggaccaaagatgcctcaacttggagccagattccccctgaagatacagcatccacc
cgatcttcattcactgtccaagaccttaaaccttttacagaatatgtgtttaggatttgc
tgtatgaaggaagatggtaagggatactggagtgactggagtgaagaagcaaatgggatc
acctatgaagatagaccatctaaagcaccaagtttctggtataaaatagatccatcccat
gctcaaggctatagaactgtacaactcatgtggaagacattgcctccttttgaagccaat
ggaaaaatcttggattatgaagtgactctcacaagatggaaatcacatttacaaaattat
acagttaatgacacaaaactgacagtaaatctcacaaatgatcgctatgtagcaacccta
acagcaagaaatcttgttggcaaatcagatgcagctgttttaactatccctgcctgtgac
tttcaagctactcaccctgtaatggatcttaaagcattccccaaagataacatgctttgg
gtagaatggactactccaagggaatctgtaaagaaatatatacttgagtggtgtgtgtta
tcagataaagcgccctgtatcgcagactggcaacaggaagatggtactgtgcatcgcacc
catttaagagggaacttagcagagagcaaatgctatttgataacagttactccagtatat
gctgacggaccaggaagccctgaatccataaaggcataccttaaacaagctccaccttcc
aaaggacctactgttcggacaaagaaagtagggaaaaacgaagctgtcttagagtgggac
caacttcctgttgatgttcagaatggatttatcagaaattatactatattttatagaacc
atcattggaaatgaaactgctgtgaatgtggattcttcccacacagaatatacattgtcc
tctttgactagtgacacattgtacatggtacgaatggcagcatacacagatgaaggtggg
aaggatggtccagaattcacttttactaccccaaagtttgctcaaggagaaattgaagcc
atagtcgtgcctgtttgcttagcgttcctattgacaactcttctgggagtgctgttctgc
tttaataagcgagacctaattaaaaaacacatctggcctaatgttccagatccttcaaag
agtcatattgcccagtggtcacctcacactcctccaaggcacaactttagttcaaaagat
caaatgtattcagatggcaatttcactgatgtaagtgttgtggaaatagaagcaaatgac
aaaaaaccttttccagaagatctgaaatcattggacctgttcaaaaaggaaaaaattaat
actgaaggacacagcagtggtattgggggttcttcatgcatgtcatcttctaggccaagc
atttctagcagtgatgaaaatgaatcttcacaaaacacttcgagcactgtccagtattct
actgtggtgcacagtggctacagacaccaagttccatccgtgcaagtcttctcaagatcc
gagtctacccagcccttgttagattcagaggagcggccagaagatctacaattagtagat
catgtagatggcagtgatgacattttgcccaggcaacagtacttcaaacagaactgcagt
cagcatgaatccagtcccgatatttcacattttgaaaggtcaaagcaagtttcatcagtc
aatgaggaagattttgttagacttaaacaacagatttcagatcatatttcacaatcctgt
ggatctggggaaatgaaaatgtttcaggaagtttctgcagcagatccttttggtccaggt
actgagggacaagtagaaagatttgaaacaattgggatggaggctgccattgatgaagga
atgcctaaaagttacttaccacagactgtacggcaaggtggctacatgcctcagtga

KEGG   Macaca mulatta (rhesus monkey): 574199
Entry
574199            CDS       T01028                                 

Gene name
IL12RB1
Definition
(RefSeq) interleukin-12 receptor subunit beta-1
  KO
K05063  interleukin 12 receptor beta-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574199 (IL12RB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574199 (IL12RB1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    574199 (IL12RB1)
   04659 Th17 cell differentiation
    574199 (IL12RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574199 (IL12RB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    574199 (IL12RB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574199 (IL12RB1)
   04090 CD molecules [BR:mcc04090]
    574199 (IL12RB1)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   574199 (IL12RB1)
CD molecules [BR:mcc04090]
 Proteins
  574199 (IL12RB1)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Interfer-bind
Other DBs
NCBI-GeneID: 574199
NCBI-ProteinID: XP_014978776
Ensembl: ENSMMUG00000012096
LinkDB
Position
19
AA seq 678 aa
MGPLVTWVVPLLLLFLRSRQGAACRTSECCFQDPPYSDADSGSASGPRDLSCYRISSAGY
ECSWQYEGPTAGVSHFLRCCLSSGRCCYFATGSATRLQFSDQAGVSVLHTVTLWVESWAR
NRTEKSPEVTLQLYKSVKYKPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSS
WKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRRLGSQGSSWSKWSSPVCVPPENPPQPQ
VRFSVEQLGRDGRRRLTLKEQPTQLELPEGCQGPAPGAEVTYQLQLHMLSCPCKAKATRT
LPLEKMPYLSGAAYNVAVISSNRFGPGPNQTWHIPADTHTEPVALNISVGTNGTTMYWPA
RAQSTTYCIEWQPVGQEGSLATCNLTAPQDPDPAGMATYSWSRESGAMGQEKCYHITIFA
SAHPKKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKE
YVVRCRDEDSNQVSEHPVQPTETQVTLSDLRAGVAYTVQVRADTAWLRGAWSQPQRFSIK
VQVSDWFIFFASLGSFLSILLVGVLGYLGLNRATRHLCPPLPTPCASSAIQFPAGKETWQ
WINPVDFQEEASLQEALVVEMSWDKGERTELLEKAELPEGAPELALDTQLSLEDGDRCKA
KVLRPSGPDGQGCNPARG
NT seq 2037 nt   +upstreamnt  +downstreamnt
atggggccgctggtgacctgggtggtccccctcctcctcctcttcctgcgatccaggcag
ggtgctgcctgcagaaccagtgagtgctgttttcaggacccaccatattcggatgcagac
tcaggctcagcctcgggccctagggacctgagctgctatcggatatccagcgctggttac
gagtgctcctggcagtatgagggtcccacagctggggtcagccacttcctgcggtgctgc
cttagctctgggcgctgttgctacttcgccacaggctcagccaccaggctgcagttctcc
gaccaggccggggtgtctgtgctgcacaccgtcacgctctgggtggaatcctgggccagg
aaccggacagagaaatctcctgaggtgaccctgcagctctacaagtcagttaaatataag
cctcctctgggagacatcaaggtgtccaagttggctgggcagctgcgtatggagtgggag
accccggataaccaggttggtgctgaggtgcagttccggcaccggacgcccagcagctca
tggaagttgggcgactgcggacctcaggatgatgatactgagtcctgcctctgtcccctg
gagatgaatgtggcccaggaatttcagctccgacgacggcggctggggagccaggggagt
tcctggagcaagtggagcagccctgtgtgtgttccccctgaaaatcccccacagcctcag
gtgagattctcagtggagcagctgggccgggatgggaggaggcggctgaccctgaaagag
cagccaacccagctggagcttccagaaggctgtcaagggccggcgcctggagcggaggtc
acctaccaactgcagctccacatgctgtcctgcccgtgtaaggccaaggccaccaggacc
ctgcccctggagaaaatgccctatctctcgggtgctgcctacaatgtggctgtcatctcc
tcgaaccgatttggtcctggcccaaaccagacgtggcacattcctgctgacacccacaca
gaaccagtggctctgaatatcagtgtcggaaccaacggaaccactatgtattggccagcc
cgggctcagagcacgacgtactgcattgaatggcagcccgtgggccaggaaggaagcctt
gccacctgcaacctgactgcgccgcaagacccggatccggctggaatggcaacctacagc
tggagtcgagagtctggggcaatggggcaggaaaagtgttaccacattactatctttgcc
tctgcgcacccaaagaagctcaccttgtggtctacggtcctgtccacctaccactttggg
ggcaatgcctcagcagctgggacaccgcaccacgtctcggtgaagaatcatagcttggac
tcagtgtccgtggactgggcaccatccctgctgagcacctgtcccggcgtcctaaaggag
tatgttgtccgctgccgagatgaagacagcaaccaggtgtcagagcatcctgtgcagccc
acagagacccaagtaaccctcagtgacctgcgggctggtgtagcctacacagtgcaggtg
cgagcagacacggcgtggctgaggggtgcctggagccagccccagcgcttcagcatcaaa
gtgcaggtttctgattggttcatcttcttcgcctccctggggagcttcctgagcatcctt
ctcgtgggcgtccttggctaccttggcctgaacagggccacacggcacctgtgcccgccg
ctgcccacaccctgtgccagctccgccattcagttccctgcagggaaggagacttggcag
tggatcaacccagtggacttccaggaagaggcatccctgcaggaggccctggtggtggag
atgtcctgggacaaaggcgagaggactgagcttcttgagaaggcagagctacctgagggt
gcccctgagctggccctggatacacagctgtccttggaggatggagacaggtgcaaggcc
aaggtcctgaggcccagtgggccagacggtcaggggtgcaaccctgcccgggggtga

KEGG   Macaca mulatta (rhesus monkey): 574300
Entry
574300            CDS       T01028                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha precursor
  KO
K05068  interleukin 2 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    574300 (IL2RA)
   04151 PI3K-Akt signaling pathway
    574300 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    574300 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    574300 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    574300 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574300 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    574300 (IL2RA)
   04659 Th17 cell differentiation
    574300 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    574300 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    574300 (IL2RA)
   05162 Measles
    574300 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    574300 (IL2RA)
   04090 CD molecules [BR:mcc04090]
    574300 (IL2RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   574300 (IL2RA)
CD molecules [BR:mcc04090]
 Proteins
  574300 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 574300
NCBI-ProteinID: NP_001028089
Ensembl: ENSMMUG00000015151
UniProt: Q5MNY4
LinkDB
Position
9
AA seq 272 aa
MDPYLLMWGLLTFITVPGCQAELCDDDPPKITHATFKAVAYKEGTMLNCECKRGFRRIKS
GSPYMLCTGNSSHSSWDNQCQCTSSAARNTTKQVTPQPEEQKERKTTEMQSQMQLADQVS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESICKMTHGKTRWTQP
QLICTGETEPSQFPGEEEPQASPDGLPESETSRLVTTTDFRIQTEVAATMETFIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKNRRTI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggatccatacctgctcatgtggggactgctcacgttcatcacggtgcctggctgccag
gcagagctctgtgacgatgacccgccaaaaatcacacatgccacattcaaagccgtggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcaccctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgctgctcggaacacaacaaaacaagtgacacctcaacctgaagaa
cagaaagaaagaaaaaccacagaaatgcaaagtcaaatgcagctggcggaccaagtgagc
cttccaggtcactgcagggaacctccaccgtgggaaaatgaagccacagaaagaatttat
catttcgtggtggggcagatggtttactaccagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcatctgcaaaatgacccacgggaagacaagatggacccagccc
cagctcatatgcacaggtgaaacggagcccagtcagtttccaggtgaagaggagcctcag
gcaagccccgacggccttcctgagagtgagacttcccgcctcgtcacaacaacagatttt
cgaatacagacagaagtggctgcaaccatggaaacgttcatatttacaacagagtaccaa
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctgctgagtgggctcacc
tggcagcggagacagaggaagaatagaagaacaatctag

KEGG   Macaca mulatta (rhesus monkey): 613027
Entry
613027            CDS       T01028                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc01522  Endocrine resistance
mcc04010  MAPK signaling pathway
mcc04012  ErbB signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04066  HIF-1 signaling pathway
mcc04068  FoxO signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04520  Adherens junction
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc04912  GnRH signaling pathway
mcc04915  Estrogen signaling pathway
mcc04921  Oxytocin signaling pathway
mcc04926  Relaxin signaling pathway
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc05160  Hepatitis C
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05213  Endometrial cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05219  Bladder cancer
mcc05223  Non-small cell lung cancer
mcc05224  Breast cancer
mcc05225  Hepatocellular carcinoma
mcc05226  Gastric cancer
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    613027 (EGFR)
   04012 ErbB signaling pathway
    613027 (EGFR)
   04014 Ras signaling pathway
    613027 (EGFR)
   04015 Rap1 signaling pathway
    613027 (EGFR)
   04630 JAK-STAT signaling pathway
    613027 (EGFR)
   04066 HIF-1 signaling pathway
    613027 (EGFR)
   04068 FoxO signaling pathway
    613027 (EGFR)
   04020 Calcium signaling pathway
    613027 (EGFR)
   04072 Phospholipase D signaling pathway
    613027 (EGFR)
   04151 PI3K-Akt signaling pathway
    613027 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    613027 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    613027 (EGFR)
   04520 Adherens junction
    613027 (EGFR)
   04540 Gap junction
    613027 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    613027 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    613027 (EGFR)
   04915 Estrogen signaling pathway
    613027 (EGFR)
   04921 Oxytocin signaling pathway
    613027 (EGFR)
   04926 Relaxin signaling pathway
    613027 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    613027 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    613027 (EGFR)
   05206 MicroRNAs in cancer
    613027 (EGFR)
   05205 Proteoglycans in cancer
    613027 (EGFR)
   05230 Central carbon metabolism in cancer
    613027 (EGFR)
   05231 Choline metabolism in cancer
    613027 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    613027 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    613027 (EGFR)
   05212 Pancreatic cancer
    613027 (EGFR)
   05225 Hepatocellular carcinoma
    613027 (EGFR)
   05226 Gastric cancer
    613027 (EGFR)
   05214 Glioma
    613027 (EGFR)
   05218 Melanoma
    613027 (EGFR)
   05219 Bladder cancer
    613027 (EGFR)
   05215 Prostate cancer
    613027 (EGFR)
   05213 Endometrial cancer
    613027 (EGFR)
   05224 Breast cancer
    613027 (EGFR)
   05223 Non-small cell lung cancer
    613027 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    613027 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    613027 (EGFR)
   05171 Coronavirus disease - COVID-19
    613027 (EGFR)
   05163 Human cytomegalovirus infection
    613027 (EGFR)
   05165 Human papillomavirus infection
    613027 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    613027 (EGFR)
   01522 Endocrine resistance
    613027 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    613027 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    613027 (EGFR)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     613027 (EGFR)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   613027 (EGFR)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   613027 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   613027 (EGFR)
  Exosomal proteins of bladder cancer cells
   613027 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 613027
NCBI-ProteinID: XP_014988922
Ensembl: ENSMMUG00000022394
UniProt: P55245
LinkDB
Position
3
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSEFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSSQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCQNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCARNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggccgcgctcctggcgctgctggctgcgctctgcccc
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaaactcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctacgtgcagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaacatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaactta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgagtttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgcggcaagtcccccagtgactgctgccacaaccagtgtgccgcgggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgcggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaatggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgtggcaggaccaagcaacacggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccagtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacgggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccagaatgtcagccgaggcagagaatgcgtggacaagtgcaac
atcctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacaggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccagcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacggatgcactgggccaggtcttgaaggctgtgcaaggaacggg
cctaagatcccatccatcgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcgg
aggctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaagaagatcaaagtgctgggctcc
ggtgcgttcggaactgtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacatctccgaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccatgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagctcattacgcagctcatgcccttcggctgcctcctggac
tacgtccgggaacacaaggacaatatcggctcccagtacctgctcaactggtgtgtgcag
attgcaaagggcatgaactacttggaggaccggcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacgccacagcatgtcaagatcacggattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctcccccagccacccatatgtacc
atcgatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtt
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgacgtggtggatgccgacgagtacctcatcccacag
caaggcttcttcagcagcccctccacgtcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttacagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtctgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccctgcgcccagc
agagacccacactaccaggacccccacagcaccgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacagccctgctcattgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcaccacaaagcagtgaatttattggagcatga

KEGG   Macaca mulatta (rhesus monkey): 641338
Entry
641338            CDS       T01028                                 

Gene name
IL2RG
Definition
(RefSeq) cytokine receptor common subunit gamma precursor
  KO
K05070  interleukin 2 receptor gamma
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    641338 (IL2RG)
   04151 PI3K-Akt signaling pathway
    641338 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    641338 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    641338 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    641338 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    641338 (IL2RG)
   04659 Th17 cell differentiation
    641338 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    641338 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    641338 (IL2RG)
   05340 Primary immunodeficiency
    641338 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    641338 (IL2RG)
   05162 Measles
    641338 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    641338 (IL2RG)
   04090 CD molecules [BR:mcc04090]
    641338 (IL2RG)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   641338 (IL2RG)
CD molecules [BR:mcc04090]
 Proteins
  641338 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind fn3 EpoR_lig-bind IL4Ra_N DUF508
Other DBs
NCBI-GeneID: 641338
NCBI-ProteinID: NP_001030606
Ensembl: ENSMMUG00000017795
UniProt: Q38JL2 G7NRV1
LinkDB
Position
X
AA seq 369 aa
MLKPSLPFRSLLVLQLPLLGVALNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNSSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGPSPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcagatccctcttagtcctgcagctgcccctgctggga
gtggcgctgaacacgacaattctgacgcccaatgggaatgaagacgccacaactgatttc
ttcctgacctctatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaattcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaagaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccggagaaccta
acacttcgcaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatagttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctccgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gccctcggggaggggcctgggccctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctgaagcctgaaacctga

KEGG   Macaca mulatta (rhesus monkey): 693569
Entry
693569            CDS       T01028                                 

Gene name
OSMR
Definition
(RefSeq) oncostatin-M-specific receptor subunit beta isoform X2
  KO
K05057  oncostatin M receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    693569 (OSMR)
   04151 PI3K-Akt signaling pathway
    693569 (OSMR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    693569 (OSMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    693569 (OSMR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   693569 (OSMR)
SSDB
Motif
Pfam: fn3 LIFR_D2 EpoR_lig-bind
Other DBs
NCBI-GeneID: 693569
NCBI-ProteinID: XP_001083745
Ensembl: ENSMMUG00000001609
LinkDB
Position
6
AA seq 977 aa
MALFVVFQTTFFLTLLSLRTYQSEVLAERLPLTPVSLKVSTNSIHQSLHLQWTVHNLPYH
QELKMVFQIQISRIETSNVVWVGNYSTTVKWNQVLHWSWESELPLECATHFVRIKSVIDD
ASFPEPNFWSNWSSWEEVSVQDYLGRGTLFVFPKDKLVEEGSNVTICYVSRNIQNNVSCY
LEGKQIHGEQLDPHVTAFNLNSVPFIRNRGTNIYCEASQGNVSKGIEGIVLFVSKVLEEP
KDFSCESQDFKTLHCTWDPGTDTALGWSKQPSQSYTLFESFSGEKKLCTHKNWCNWQITQ
DSQEMYNFTLIAENYLRKRSVNILFNLTHRVYLMNPFSVNFENVNATNAIMTWKVHSMRN
NFTYLCQIELHGEGKMMQYDVSINVNGEYFLSELEPATEYMARVRCADASHFWKWTEWSG
QNFTTLEAAPSEAPDVWRSVNSEPGNHTVTLFWKPLSKLHANGKILFYNVVVENLDKPSR
SELRSIPAPANSTKLILDRCSYQICVTANNSVGASPASIIVISADPENKEVEEERIAGTE
GGFSLSWKPQPGDVIGYVVDWCDHPQDVLQWKNVGPNTTSTVISTDAFRPGVRYDFRIYG
LSTKRIACLLEKKTGYSQELAPSDNPHVLVDMLTSHSFTLSWKDYSTESQPGFIQGYHVY
LKSKARQCHPRFQKAVLSDGSECCKYKIDNPEEKALIVDNLKPESFYEFFVTPFTSAGEG
PNATFTKVTTPDEHSSMLIRILLPMVFCVLLIMIVCYLKSQWIKETCYPDIPDPYKSSIL
SLIKFKENPHLTIMNVSDCIPDAIEVVSKPEGTKIQLLGTRKSLTETELTKPNYLYLLPT
EKNHSGPGPCICFENFTYNQAASDAGSCGHVPVPPKAPPSMLGLMTSPENVLKALEKNYM
NSLGEVPAGETSLNYVSQLASPMSGDKDSLPTNPVEPPHCSEYKMQMAVPLRLALPPPTE
NSSLSSITLLDPGEHYR
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggctctatttgtagtctttcagacaacattcttcttaacattgctgtccttgaggact
taccagagtgaagtcttggctgaacgtttaccattgactcctgtgtcacttaaagtttcc
accaattctatacatcagagtttgcatttacaatggactgtccacaaccttccttatcat
caggaattgaaaatggtatttcagatccagatcagtaggattgaaacatccaatgtcgtc
tgggtggggaattacagcaccactgtgaagtggaaccaggttctgcattggagctgggaa
tcggaactccctttggaatgtgccacacactttgtaagaatcaagagtgtgatagacgat
gccagtttccctgagccaaatttctggagcaactggagttcctgggaggaagtcagtgta
caagattatcttggacggggcacattgttcgttttccctaaagataagctggtggaagaa
ggctccaatgttaccatttgttatgtttctaggaacattcaaaataatgtatcctgttat
ttggaagggaaacagattcacggagaacagcttgatccacatgtaactgcattcaacttg
aatagtgtgcctttcattaggaatagagggacaaatatctattgtgaggcgagtcaagga
aatgtcagtaaaggcatagaaggcatcgttctctttgtctcaaaagtacttgaggagccc
aaggacttttcttgtgaatcccaggacttcaagactttgcactgtacttgggatcctggg
acggacactgccttggggtggtctaaacaaccttcccaaagctacactttatttgaatca
ttttctggggaaaagaaactttgtacgcacaaaaactggtgtaattggcaaataactcaa
gactcacaagaaatgtataacttcacactcatagctgaaaattacttaaggaagagaagt
gtcaatatcctttttaacctgactcatcgagtttatttaatgaatccttttagtgtcaac
tttgaaaatgtaaatgccacaaacgccatcatgacctggaaggtgcactccatgaggaat
aatttcacatatttgtgtcagattgaactccatggtgaaggaaaaatgatgcaatacgat
gtttctatcaacgtgaacggtgagtacttcttaagtgaactggaacctgccacagaatat
atggcccgagtacgctgtgctgatgccagccacttctggaaatggactgaatggagtggt
cagaacttcaccacacttgaagctgctccgtcagaggcccctgatgtctggagaagtgtg
aactcagagccaggaaatcatactgtgaccttattctggaagccattatcaaaactgcat
gccaatggaaagatcctgttctataatgtagttgtagaaaacctagacaaaccgtccagg
tcagagctccgttccattccggcaccagccaacagcacaaaactaatcctcgacaggtgt
tcctaccaaatctgcgtcacagctaacaacagtgtgggcgcttctcctgcttctataata
gtcatctctgcggaccctgaaaacaaagaggttgaggaagaaagaattgcaggcacagag
ggtggattctctctgtcttggaaaccccagcctggagatgttataggctatgttgtggac
tggtgtgaccatccccaggatgtgctccagtggaagaatgtaggtcccaataccacaagc
acagtcattagcacagatgcttttaggccaggagttcgatacgacttcagaatctatggg
ttatctacaaaaaggattgcttgtttattagagaaaaaaacaggatactctcaggaactg
gctccttcagacaaccctcacgtgctggtagatatgttgacatcccactccttcactctg
agttggaaagattactctactgaatctcaacctggttttatacaagggtaccatgtctat
ctgaaatccaaggcgaggcagtgccacccacgatttcaaaaggcagttctttcagatggt
tcagaatgttgcaaatacaaaattgacaacccagaagaaaaggcattgattgtggacaac
ctaaagccagaatccttctatgagtttttcgttactccattcactagtgctggcgagggc
cccaatgctacgttcacgaaggtcacgactccggatgaacactcctccatgttgattcgt
atcctactgcccatggttttctgcgtcttgctcatcatgatcgtgtgctacttgaaaagt
cagtggatcaaggagacgtgttatcctgacatccctgacccttacaagagcagcatcctg
tcgttaataaaattcaaggagaaccctcacctaacaataatgaatgtcagtgactgtatc
ccagatgctattgaagttgtcagcaagccagaagggacaaagatacagctcctaggcact
aggaagtcactcacagaaactgagttaactaagcctaactacctttatctccttccaaca
gaaaagaatcactctggccctggcccctgcatctgttttgagaactttacctacaaccag
gcagcttctgacgctggctcttgtggccatgttccagtaccccccaaagccccaccaagt
atgctaggactaatgacctcacctgaaaatgtactaaaggcgctagaaaaaaactacatg
aactccctgggagaagtcccagctggagaaacaagtttgaattatgtgtcccagttggct
tcacccatgtctggagacaaggacagtctcccaacaaacccagtggagccaccacactgt
tcagagtataaaatgcaaatggcagtccccctgcgtcttgccctgcctcccccgaccgag
aatagcagcctttcctcaattacccttttagatccaggtgaacactaccgctaa

KEGG   Macaca mulatta (rhesus monkey): 694139
Entry
694139            CDS       T01028                                 

Gene name
LIFR
Definition
(RefSeq) leukemia inhibitory factor receptor isoform X1
  KO
K05058  leukemia inhibitory factor receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04550  Signaling pathways regulating pluripotency of stem cells
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    694139 (LIFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    694139 (LIFR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    694139 (LIFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    694139 (LIFR)
   04090 CD molecules [BR:mcc04090]
    694139 (LIFR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   694139 (LIFR)
CD molecules [BR:mcc04090]
 Proteins
  694139 (LIFR)
SSDB
Motif
Pfam: LIFR_D2 LIFR_N fn3 EpoR_lig-bind Pur_ac_phosph_N IL6Ra-bind TMEM154 DUF3827
Other DBs
NCBI-GeneID: 694139
NCBI-ProteinID: XP_014995407
Ensembl: ENSMMUG00000007386
UniProt: F7E0D3
LinkDB
Position
6
AA seq 1097 aa
MMDIYVCLKRASWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPRDLKCVTNNL
QVWDCYWKAPSGTGRGTDYEVCIENRSHSCYQLEKTNIKIPALSHGDYEITINSLHDFGS
STSKFTLNEQNVSLIPDTPEILNLSADFSTSTLYLKWNDRGSVFPHHSNVIWEIKILRKE
SMELVKLVTHNTTLNGKDTLHHWSWASDMPLECAIHFVEIRCYIDSLHFSGRKEWSDWSP
VKNISWMPDSQTKVFPQDKVILVGSDITFCCISQEKVLSALIGHTNCPLIHLDGENVAIK
IHNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEILCSWNPGRATA
LVGPRATSYTLLESFSGKYVRFKRAEAPTNGSYQLFFQMLPNQEIYNFTLNAHNPLGRSE
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCQIEIKKSNTVQEQR
NVTIKGVENSSYLVALDKLNPYTVYTFRIRCSTETFWKWSKWSNKKQHLTTEAIPSKGPD
TWREWSSDGKNLIIYWKPLPINEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIQLDK
NDYIISVVAKNSVGSSPPSKIASMEIPNDDLKIEQVVGMGKGILLTWHYDPNMTCDYVIK
WCNSSRSEPCLMDWRKVPSNSTETVIESDQFRPGVRYNFFLYGCRNQGYQLLRSMIGYIE
ELAPTVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDTSKMRVLESGR
SDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSGLKTLEM
NPCTPNNVEVLETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPN
PAADEAGGTAQVIYIDVQSMYQPQAKPEEEQENDPVGGAGYKPQMHLPVNSTVEDIAAEE
DLEKTAGYRPQANVNTWNLVSPDSPRSIDSNSEIVSFGSPCSINSRQFLIPPKDEDSPKS
NGGGWSFTNFFQNKPND
NT seq 3294 nt   +upstreamnt  +downstreamnt
atgatggatatttacgtgtgtttgaaacgagcatcctggatggtggacaataaaagaatg
aggactgcttcaaatttccagtggctcttatcaacatttattcttctatatctaatgaat
caagtaaatagccagaaaaagggagctcctcgtgatttgaagtgtgtaactaacaatttg
caagtgtgggactgttattggaaagcaccctctggaacaggccgtggtactgattatgaa
gtttgcattgaaaacaggtcccattcttgttatcaactagagaaaacaaatattaaaatt
ccagctctttcacatggtgattatgaaataacaataaattctctacatgattttggaagt
tctacgagtaaattcacactaaatgaacaaaacgtttccttaattccagatactccagag
atcttgaatttgtctgctgatttctcaacctctacattatacctaaagtggaatgacagg
ggttcagtttttccacaccactcaaatgttatctgggaaattaaaattctacgtaaagag
agtatggagctcgtaaaattagtgacccacaacacaactctgaatggcaaagatacactt
catcactggagttgggcctcagatatgcccttggagtgtgccattcattttgtggaaatt
agatgctacattgacagtcttcatttttctggtcgcaaagagtggagtgactggagccct
gtgaagaacatttcttggatgcctgattctcagactaaggtttttcctcaagataaagtg
atacttgtaggctcagacataacattttgttgtataagtcaagaaaaagtgttatcagca
ctgattggccatacaaactgccccttgatccatcttgatggggaaaatgttgcaatcaag
attcataatatttctgtttctgcaagtagtggaacaaatgtggtttttacaaccgaagat
aacatatttggaactgttatttttgctggatatccaccagatactcctcaacaactgaat
tgtgagacacatgatttaaaagaaattctatgtagttggaatccaggaagggcgacagca
ttggtgggcccacgtgctacaagttacactttacttgaaagtttttcaggaaaatatgtt
agatttaaaagagctgaagcacctacaaatggaagctatcaattattctttcaaatgctt
ccaaatcaagaaatatataattttactttgaatgcccacaatcctctgggtcgatcagaa
tcaacaattttagttaatataactgaaaaagtttatccccatactcctacttcattcaaa
gtgaaggatattaattcaacagctgttaaactttcttggcatttaccaggcaactttgca
aagattaattttttatgtcaaattgaaattaagaaatctaatacagtacaagaacagcgg
aatgtcacaatcaaaggagtagaaaattcaagttatcttgttgctctggacaagttaaat
ccatacactgtatatacttttcggattcgttgttctactgaaactttctggaaatggagc
aaatggagcaataaaaaacaacatttaaccacagaagccattccttcaaaggggcctgac
acttggagagagtggagttctgatggaaaaaatttaataatctattggaagcctttaccc
attaatgaagctaatggaaaaatactttcctacaatgtgtcatgttcatcagatgaggaa
acacagtccctttctgaaatccctgatcctcagcacaaagcagagatacagcttgataag
aatgactacatcatcagcgtggtggctaaaaattctgtgggctcgtcaccaccttccaaa
atagcgagtatggaaattccaaatgatgatctcaaaatagagcaagttgttgggatggga
aagggcattctcctcacctggcattacgaccccaacatgacttgtgactacgtcattaag
tggtgtaactcgtctcggtcggaaccatgccttatggactggagaaaagtcccctcaaac
agcactgaaactgtaatcgaatctgatcagtttcgaccaggtgtaagatataattttttc
ctgtatgggtgcagaaatcaaggatatcaattattacgctccatgattggatatatagaa
gaattggctcccactgttgcaccaaattttactgttgaggatacttctgcagattcgata
ttagtaaaatgggaagacattcctgtggaagaacttagaggctttttaagaggatatttg
ttttactttggaaaaggagaaagagacacatcaaagatgagggttttagaatcaggtcgt
tctgacataaaggttaagaatattactgacatatcccagaagacactgagaattgctgac
cttcaaggtaaaacaagttaccacctggtcttgcgagcctatacagatggtggagtgggc
ccagagaagagtatgtacgtggtgacaaaggaaaattctgtgggattaattattgccatt
ctcatcccagtggcagtggctgtcattgttggagtggtgacaagtatcctttgttatcgg
aagcgagaatggattaaagaaaccttctaccctgatattccaaatccagaaaactgtaaa
gcgttacagtttcaaaagagtgtctgtgagggaagcagtggtcttaagacattggaaatg
aatccttgtaccccaaataatgttgaggttctagaaactcgatcagcgtttcctaaaata
gaagatacagaaataatttcgccagtagctgagcgtcctgaagatcgctctgatgcagag
cctgaaaaccatgtggttgtgtcctattgtccacccatcattgaggaagaaataccaaac
ccagcagcagatgaagctggagggactgcacaggtcatttacattgatgttcagtcgatg
tatcagcctcaagcaaaaccagaagaagaacaagaaaatgaccctgtaggaggggcaggc
tataaaccacagatgcacctccccgttaattctactgtggaagatatagctgcagaagag
gacttagagaaaactgcgggttacagacctcaggccaatgtaaatacatggaatttagtg
tctccagactctcctagatccatagacagcaacagtgagattgtctcatttggaagtcca
tgctccattaattcccgacaatttttgattcctcctaaagatgaagactctcctaaatct
aatggaggagggtggtcctttacaaacttttttcagaacaaaccaaacgattaa

KEGG   Macaca mulatta (rhesus monkey): 696331
Entry
696331            CDS       T01028                                 

Gene name
IL2RB
Definition
(RefSeq) interleukin-2 receptor subunit beta precursor
  KO
K05069  interleukin 2 receptor beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05162  Measles
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
mcc05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    696331 (IL2RB)
   04151 PI3K-Akt signaling pathway
    696331 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    696331 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    696331 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    696331 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    696331 (IL2RB)
   04659 Th17 cell differentiation
    696331 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    696331 (IL2RB)
   05202 Transcriptional misregulation in cancer
    696331 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    696331 (IL2RB)
   05162 Measles
    696331 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    696331 (IL2RB)
   04090 CD molecules [BR:mcc04090]
    696331 (IL2RB)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   696331 (IL2RB)
CD molecules [BR:mcc04090]
 Proteins
  696331 (IL2RB)
SSDB
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind
Other DBs
NCBI-GeneID: 696331
NCBI-ProteinID: NP_001244989
Ensembl: ENSMMUG00000005417
UniProt: H9Z8K1
LinkDB
Position
10
AA seq 551 aa
MATLALSWCLPLLILLLPLATSSASAAVNGTSRFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGTPDSQKLTAVDIVTLRVMCREGVRWRMMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWKISQASHYFERHLEFEARTLSPGHTWEE
APLMTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCHTPDPSKFFSQLTSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPSSLSSNRSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPCAEEEPDEGGADAPTGSSPQPLRPLSAEDDAYCT
FPSGDDLLLFSPSLLGGPSPPSTAPGGSGAGEERLPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPRPELVLREAGEQVPDPGPREPFSFPWARPPGQGEVRALNARLPLNTDAYLSLQ
ELQDQDPTHLV
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggcgacccttgctctgtcctggtgtctgcccctcctcatcctcctcctgcccctggct
acctcttcggcatctgcagcggtgaatggcacttcccggttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccacgcctggccggacagacggcggtggaaccaaacctgtgagctgctccctgtgagt
caagcatcctgggcctgcaacctgatcctcggaaccccagattctcagaaactgaccgca
gtggacatcgtcaccctgagggtgatgtgccgtgaaggggtgcgatggaggatgatggcc
atccaggacttcaaaccctttgagaaccttcgcctgatggcccccatctccctccaagtc
gtccacgtggagacccacagatgcaacataagctggaaaatctcccaagcctcccactac
tttgaaagacacctggagtttgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgatgaccctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcctttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
cacaccccggacccttcgaagttcttttcccagctgacctcagagcatggaggagatgtc
cagaagtggctctcctcgcccttcccctcatcgtccttcagccctggcggcctggcgcct
gagatctcgccactggaagtgctggagagggacaaggtgacacagctgctcctgcagcag
gacaaggtgcctgagccctcatccttaagcagcaaccgctcactgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttatgatccctgcgcagaggaagagcctgatgagggtggggccgacgcgccc
acagggtcttccccccaacccctgcggcctctgtccgcggaggacgatgcctactgcacc
ttcccctccggggatgacctgctgctcttctccccaagtctccttggtggccccagcccc
ccaagcactgcccctgggggcagcggggctggtgaagagaggctacccccttccctgcag
gagagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccacgccctgagctggtgctgcgagaggctggagagcaggtc
cctgatcctggccccagggagccgttcagtttcccctgggcgaggcctcctgggcagggg
gaggtcagggcccttaatgctcgcctgcccctgaacactgatgcttacttgtccctccaa
gaactccaggatcaggacccaactcacttggtgtag

KEGG   Macaca mulatta (rhesus monkey): 697002
Entry
697002            CDS       T01028                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04144  Endocytosis
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    697002 (PDGFRA)
   04014 Ras signaling pathway
    697002 (PDGFRA)
   04015 Rap1 signaling pathway
    697002 (PDGFRA)
   04630 JAK-STAT signaling pathway
    697002 (PDGFRA)
   04020 Calcium signaling pathway
    697002 (PDGFRA)
   04072 Phospholipase D signaling pathway
    697002 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    697002 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    697002 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697002 (PDGFRA)
   04540 Gap junction
    697002 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    697002 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697002 (PDGFRA)
   05206 MicroRNAs in cancer
    697002 (PDGFRA)
   05230 Central carbon metabolism in cancer
    697002 (PDGFRA)
   05231 Choline metabolism in cancer
    697002 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    697002 (PDGFRA)
   05218 Melanoma
    697002 (PDGFRA)
   05215 Prostate cancer
    697002 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    697002 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    697002 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    697002 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    697002 (PDGFRA)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     697002 (PDGFRA)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   697002 (PDGFRA)
CD molecules [BR:mcc04090]
 Proteins
  697002 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 697002
NCBI-ProteinID: XP_014994177
Ensembl: ENSMMUG00000017395
UniProt: G7MTB0 A0A5F8AGH5
LinkDB
Position
5
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLHNSEGVVPASYNSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKRVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGMPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGLVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADDSTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcgttaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaactctgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacagtcttggaagtgagcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggacgatgattctgccatcataccttgtcgcacaactgatcctgagactcctgtaact
ttacacaacagtgagggggtggtacctgcctcctacaacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagagagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
tttagccagttggaagctgtcaacctgcatgaagtcaaacattttgtcgtagaggtgcag
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaacctc
acggagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
cttatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gatgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gtcgatgatcaccatggctcaactgggggacagacggtgaggtgcacagctgaaggcatg
ccacttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccttgtgacttttgccaaagtggaagagaccattgcggtgaga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgccgcagtcctggtgctgctggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccagatggacatgaatatatttatgtggacccaatgcagctg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagagtactgcttctacgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccgccacccagagaag
ccaaagaaagagctggatatctttgggttgaaccctgctgatgacagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccctatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctgtatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttgttggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggatctggct
gctcgcaacgtcctcctggcacaaggaaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggtactccttaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagcggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

KEGG   Macaca mulatta (rhesus monkey): 697508
Entry
697508            CDS       T01028                                 

Gene name
CSF2RB
Definition
(RefSeq) cytokine receptor common subunit beta isoform X1
  KO
K04738  cytokine receptor common subunit beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04210  Apoptosis
mcc04630  JAK-STAT signaling pathway
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    697508 (CSF2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    697508 (CSF2RB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    697508 (CSF2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697508 (CSF2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    697508 (CSF2RB)
   04090 CD molecules [BR:mcc04090]
    697508 (CSF2RB)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   697508 (CSF2RB)
CD molecules [BR:mcc04090]
 Proteins
  697508 (CSF2RB)
SSDB
Motif
Pfam: IL6Ra-bind IL4Ra_N fn3 Tissue_fac EpoR_lig-bind IL2RB_N1 Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 697508
NCBI-ProteinID: XP_015005742
Ensembl: ENSMMUG00000012351
LinkDB
Position
10
AA seq 898 aa
MALAQRLLSMALLALCWGHSLPGAEETIPLRTLRCYNDYTSHITCRWADTQDAQRLVNVT
LSRRVNDRDPPEPVSCDLSEDMPWSACPYPRCVPRRCVIPYQSFVVTDVDYYSFQPDRPL
GTQLTVTLTQHVQPPAPKDLQINTDQDHFLLTWSVAPGSPQSHWLSLGDLESEVVYKRLQ
DSWEDAATLLSNASQATLGPEHLMPSSTYVARVRTRLASGSRLSGRPSEWSPEVRWDSQP
GDEAQPQNLQCFFDGAAVLSCSWEVRQEVASSISFGLFYKPSPDAGEEECSPVLREGLGS
LYTRHHCQIPVPDPGTHGQYIVSVQPRRAEKRIKSSENIQMAPPSLNVTRDGDSYSLRWE
TMKMQYEHIDHTFEIQYTKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRT
GYNGTWSDWSEVCSWDTESVLPMWVLALVVIFLTIAVLLALRFCGIYGYRLRRKWEERIP
NPSKSHLFQNGSAELWTPGSMMAFTSGSPLHQGPWDNRFPELEGVFPVGFGDSEVSPLTI
EDLRHVCDPPSGPDTTPAASDLPTEQPPSPQPGPPASSHSPEKQVSSFDFNGPYLGPPHS
RSLPDILGQPEPPQACGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGHGQAMDVERRPS
QGAAGSSSLESEGDPAPPALGPRVGGQDPKDSPVAIPASSGVPEDPGVASGYVSSADLVL
PPHSGASALSLVPSPGIPSDQTPSFCPGLASGPPGAPGPVKSGFEGYVELPPTEGQSPKS
PVNNLVPPEVRSPVLNPGERRADVSPTSPQPEGLLVLQQVGDYCFLPGLGPGPLSPRSKP
SSPGPCPEIRDLDQACQVKKPPGQAVPQVPVIQLFKVLKQQDYLCLPPWEVNKPGEVC
NT seq 2697 nt   +upstreamnt  +downstreamnt
atggcgctggcccagaggctgctctccatggccctgctggccctgtgctgggggcacagc
ctgccaggggcagaagaaaccatcccgctgcggaccctacgctgctacaatgactacacc
agccacatcacctgcaggtgggcggacacccaggatgcccagcggcttgtcaacgtgacc
ctcagtcgccgggtgaatgacagggaccctccagagccagtgtcctgtgacctcagtgaa
gacatgccctggtcagcctgcccctatccccgctgcgtgcccaggagatgtgtcatacct
taccagagttttgtcgtcacggacgttgactactactcattccaaccagacaggcctctg
ggcacccagctcaccgtcactctgacccagcatgtccagcctcctgcgcccaaggacctg
cagatcaacaccgaccaggaccacttcctgctgacctggagtgtggcccctgggagtccc
cagagccactggttgtccctgggggatctggagtctgaggtggtctacaagcggctccag
gattcttgggaggatgcagccaccctcctctccaacgcctcccaggccaccctggggcca
gagcacctcatgcccagcagcacctatgtggcccgagtgcggacccgcctggcctcaggc
tctcggctctcgggacgtcccagcgagtggagcccagaggttcgctgggactcccagcca
ggggacgaggcccagccccagaacctgcagtgcttctttgacggggccgccgtgctcagc
tgctcctgggaggtgaggcaggaggtggccagctcaatctcctttggcctcttctacaag
cctagcccagatgcaggggaggaagagtgctccccagtgctgagggaggggctcggcagc
ctctacaccaggcaccactgccagattcccgtgcccgaccccgggacccatggccaatac
atcgtctccgttcagccaaggagggcagagaaacgcataaagagctcagaaaacatccag
atggcccctccatccctcaacgtgaccagggatggagacagctacagtctgcgctgggaa
acaatgaaaatgcaatacgaacacatagaccacacatttgagatccagtacacgaaagac
acggccacgtggaaggacagcaagactgagaccctccagaacgcccacagcatggccctg
ccagccctggagccctccaccagatactgggccagggtgagggtcaggacctcccgcacc
ggctacaatggaacctggagcgactggagtgaggtgtgctcctgggacaccgagtcggtg
ctgcccatgtgggtgctggctctcgttgtgatcttcctcaccatcgctgtgctcttggcc
ctccgcttctgtggcatctacgggtacaggctgcgtagaaagtgggaggagaggatcccc
aaccccagcaagagccacctgttccagaacgggagtgcagagctttggaccccaggcagc
atgatggccttcaccagcgggagccccctacaccaggggccgtgggacaaccgcttccct
gagctggagggggtgttccctgtaggattcggggacagcgaggtgtcacctctcaccata
gaggacctcaggcatgtctgtgatccaccatctgggcctgacacgactccagctgcctcc
gatctgcccacagagcagccccccagcccccagccaggcccgcctgcctcctcccactcg
cctgagaagcaggtttccagctttgacttcaatgggccctacctggggccgccccacagc
cgctccctgcctgacatcctgggccagccagagcccccacaggcgtgtgggagccagaag
tccccacctccggggtccctggagtacctgtgtctgcctgctggggggcaggtgcagctg
gtccctctggcccaggcgatgggacatggccaggccatggacgtggagaggaggccgagc
cagggggctgcagggagttcctccctggagtccgagggagaccctgcccctcctgctctt
gggccaagggtgggaggacaggacccaaaggacagccctgtggctatacccgcgagctct
ggggttcctgaggaccctggagtggcctctggttacgtctcctctgcagacctggtactc
cccccacactcaggggcctcggctctctccctggttccctctccgggcatcccctcagac
cagacccccagcttctgtcctgggctggccagtggaccccctggagccccaggccctgtg
aagtcagggtttgagggctatgtggagctccctccaactgagggccagtcccccaagtcc
ccagtgaacaatcttgtcccccctgaggtcagaagccctgtcctgaatccaggggaacgc
cgggcagatgtgtccccaacatccccacagcccgagggcctccttgtcctgcagcaggtg
ggcgactattgcttcctccccggtctgggccccggccctctctcaccacggagtaaaccc
tcttccccgggaccctgtcctgagatcagggatctagaccaggcttgtcaagtcaagaag
cccccaggccaggctgtgccccaggtgcccgtcattcagctgttcaaagtcctgaagcag
caggactacctgtgtctgcccccttgggaggtcaacaagcctggggaggtgtgttga

KEGG   Macaca mulatta (rhesus monkey): 697986
Entry
697986            CDS       T01028                                 

Gene name
GHR
Definition
(RefSeq) growth hormone receptor precursor
  KO
K05080  growth hormone receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    697986 (GHR)
   04151 PI3K-Akt signaling pathway
    697986 (GHR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    697986 (GHR)
   04060 Cytokine-cytokine receptor interaction
    697986 (GHR)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    697986 (GHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    697986 (GHR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  Prolactin receptor family
   697986 (GHR)
SSDB
Motif
Pfam: GHBP EpoR_lig-bind fn3
Other DBs
NCBI-GeneID: 697986
NCBI-ProteinID: NP_001036132
Ensembl: ENSMMUG00000001336
UniProt: P79194
LinkDB
Position
6
AA seq 638 aa
MDLWQLLLTLALAGSSDAFSGSEPTAAILSRASWSLQSVNPGLKTNSSKEPKFTKCRSPE
RETFSCHWTDAVHHGSKSLGPIQLFYTRRNIQGQTQEWKECPDYVSAGENSCYFNSSFTS
VWIPYCIKLTSNGDTVDGKCFSVDEIVQPDPPIALNWTLLNVSLTGIHADILVRWEAPPN
ADIQKGWMVLEYELQYKEVNETKWKMMDPILSTSVPVYSLKVDKEYEVLVRSKRRNSRNY
GEFSEVLYVTLPQMNQFTCEEDFYFPWLLIIIFGIFGLTVMLFVFLFSKQQRIKMLILPP
VPVPKIKGINPDLLKEGKLEEVNAILAIHDSYKPEFHSDDSWVEFIELDIDEPDEKNEGS
DTDRLLSSDHQKSHSNLGVKDGDSGRTSCYEPDILETDFNANNIHEGTSEVAQPQRLKGE
ADLLCLDQKNQNKSPYHDACPATQQPSVIQAEKNKPQPLPTDGAESTHQAAHIQLSNPSS
LANIDFYAQVSDITPAGSVVLSPGQKNKAGMSQCDMHLEMVSLCQEDFIMDNAYFCEADA
KKCIPVAPHIKVESHIEPSFNQEDIYITTESLTTTAGRPGTTEHIPGSEMPVPDYTSIHI
VQSPQGLILNATALPLPGKEFLSSCGYVSTDQLNKIMP
NT seq 1917 nt   +upstreamnt  +downstreamnt
atggatctctggcagctgctgttgaccttggcactggcaggatcaagtgatgctttttct
ggaagtgagcccacagcagctatccttagcagagcatcctggagtctgcaaagtgttaat
ccaggcctaaagacaaactcttctaaggagcctaaattcaccaagtgtcgttcacctgag
cgagagactttttcatgccactggacagatgcggttcatcatggttcaaagagcctagga
cccatacagctgttctataccagaaggaatattcaaggacagactcaagaatggaaagaa
tgccctgattatgtttctgctggggaaaacagctgttactttaattcatcatttacctcc
gtctggataccttattgtatcaagctaactagcaatggtgatacagtggatggaaagtgt
ttctctgttgacgaaatagtgcaaccagatccacccattgccctcaactggactttactg
aacgtcagtttaactgggattcatgcagatattcttgtgagatgggaagcaccacccaat
gcagatattcagaaaggatggatggttctggagtatgaacttcaatacaaagaagtaaat
gaaactaaatggaaaatgatggatcctatattgtcaacatcagttccagtgtactcattg
aaagtggataaggaatatgaagtgctggtgagatccaaacgacgaaactctagaaattat
ggcgagttcagtgaggtgctctatgtaacacttcctcagatgaaccaatttacatgtgaa
gaagatttctactttccatggctcttaattattatctttggaatatttgggctaactgtg
atgctatttgtattcttattttctaaacagcaaaggattaaaatgctgattctgccccca
gttccagttccaaagattaaaggaatcaatccagatctcctcaaggaaggaaaattagag
gaggtgaacgcaatcttagccattcatgatagctataaacccgaattccacagtgatgac
tcttgggttgaatttattgagctagatattgatgagccagatgaaaagaatgagggatca
gacacagacagacttctaagcagtgaccatcagaaatcacatagtaacctaggggtgaag
gatggcgactctggacgtaccagctgttatgaacctgacattctggagactgatttcaat
gccaataacatacatgagggcacctcagaggttgctcagccacagaggttaaaaggggaa
gcagatctcttatgccttgaccagaagaatcaaaataagtcaccttatcatgatgcttgc
cctgctactcagcagcccagtgttatccaagcagagaaaaacaaaccacaaccacttcct
actgatggagctgagtcaactcatcaagctgcccatattcagctaagtaatccaagttca
ctggcaaacatcgacttttatgcccaggtgagcgacattacaccagcaggtagtgtggtc
ctttccccaggccaaaagaataaggcagggatgtcccagtgtgacatgcacctggaaatg
gtctcactctgccaagaagacttcattatggacaatgcctacttctgtgaggcagatgcc
aaaaagtgcatccctgtggctcctcacatcaaggttgaatcacacatagagccaagcttt
aaccaagaggacatttacatcaccaccgaaagccttaccactactgctgggaggcctggg
acaacagaacatattccaggttctgagatgcctgtcccagactatacctccattcatata
gtacagtccccacagggcctcatactcaatgcaactgccttgcccttgcctggcaaagag
tttctctcgtcgtgtggctatgtgagcactgaccaactgaacaaaatcatgccttag

KEGG   Macaca mulatta (rhesus monkey): 699369
Entry
699369            CDS       T01028                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor
  KO
K05081  prolactin receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    699369 (PRLR)
   04151 PI3K-Akt signaling pathway
    699369 (PRLR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    699369 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    699369 (PRLR)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    699369 (PRLR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    699369 (PRLR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  Prolactin receptor family
   699369 (PRLR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind GHBP
Other DBs
NCBI-GeneID: 699369
NCBI-ProteinID: XP_001092241
Ensembl: ENSMMUG00000006302
LinkDB
Position
6
AA seq 619 aa
MKENVISATVFTLLLFLNTCLLNGQLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNY
SLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYVMMVNATNQMGSSFSDELYVD
VTYIVQPDPPLELTVEVKQPEDRKPYLWMKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEW
ETHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFIMNDTTVWIS
VAVLSAVICLIIVWAVALKGYSMVTCIFPPVPGPKIKGFDAHLLEKGKSEELLSALGCQD
FPPTSDYEDLLVEYLEVDDSEDQHLMSVHSKEHPSQGMKPTYLDPDTDSGRGSCDSPSLL
SEKCEEPQANPSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLIQ
HNPRSSYHNITDVCELAVGPADAPATLLDEAGKDALKSSQTIKSREEGKAAQQREVDSFH
SKTDQDTPWLLPQEKTPFGSAKPLDYVEIHKVNKDGALALLPKQRENSGQPEKPRAPENS
KEYAKVSGVMDNNILVLVPDPHAKNVACFEESAKEAPPSLEQNQAEQDLANCTATPSKCR
IQLGGLDYLDPACFTHSFH
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgaaggaaaatgtgatatctgcaactgttttcactctgctactttttctcaacacctgc
cttctgaatggacagttacctccaggaaaacctgagatctttaaatgtcgttctcccaat
aaggaaacattcacctgctggtggaggcctgggacagatggaggacttcctaccaattat
tcgctgacttaccacagggaaggagagacactcatgcatgaatgtccagactacataact
ggtgggcccaactcctgccactttggcaagcagtacacctccatgtggaggacatacgtc
atgatggtcaatgccactaaccagatgggaagcagtttctcggatgaactctacgtggac
gtgacttacatagttcaaccagaccctcctttggagctgactgtggaagtaaaacagcca
gaagatagaaaaccctacctgtggatgaaatggtctccacctaccctgattgacttgaaa
actggttggttcacactcctgtatgaaattcgattaaaacccgagaaagcagctgagtgg
gagacccattttgctgggcagcaaacagagtttaagattctcagcctacatccaggacag
aaataccttgtccaggttcgctgcaaaccagatcatggatactggagtgcatggagtcca
gcgaccttcattcagatacctagtgacttcatcatgaatgatacaaccgtgtggatctct
gtggctgtcctttctgctgtcatctgtttgattattgtctgggcagtggctttgaagggc
tatagcatggtgacctgcatctttccaccagttcctgggccaaaaataaaaggatttgat
gctcatctgttggagaagggcaagtctgaagaactactgagtgccttgggatgccaagac
tttcctcccacttctgactatgaggacttgctggtggagtatttagaagtagacgacagt
gaggaccagcatctaatgtcagtccattcaaaagaacacccaagtcaaggtatgaaaccc
acatacctggatcctgacactgactcaggccgggggagctgcgacagcccttcccttttg
tctgaaaagtgtgaggaaccccaggccaatccctccacattctatgatcctgaggtcatt
gagaagccagagaatcctgaaacaacccacacctgggacccccagtgcataagcatggaa
ggcaaaattccctattttcatgctggcgggtccaaatgttcaacatggcccttaatacag
cacaaccccagatcctcctaccacaatattactgatgtgtgtgagctggctgtgggccct
gcagatgcaccggccactctgttggacgaagcaggtaaagatgctttaaaatcctctcaa
accattaagtctagagaggagggaaaggcagcccagcagagggaggtggatagcttccat
tccaagactgaccaagatacgccctggctgctgccccaggagaaaaccccctttggctcc
gctaaacccttggattatgtggagattcacaaggtcaacaaagatggcgcattagcattg
ctaccaaaacagagagagaacagcggccagcccgagaagcccagggctcctgagaacagt
aaggagtatgccaaagtgtccggggtcatggataacaacatcctggtgttggtgccggat
ccgcatgctaaaaatgtggcttgctttgaggaatcagccaaagaggccccaccatcactt
gaacagaatcaagctgagcaagacctggccaactgcactgcgacaccaagcaagtgcagg
atccagctgggtggtttggattacctggatcccgcatgttttacgcactcctttcattga

KEGG   Macaca mulatta (rhesus monkey): 699489
Entry
699489            CDS       T01028                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04066  HIF-1 signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05140  Leishmaniasis
mcc05142  Chagas disease
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05164  Influenza A
mcc05168  Herpes simplex virus 1 infection
mcc05200  Pathways in cancer
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    699489 (IFNGR2)
   04066 HIF-1 signaling pathway
    699489 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    699489 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    699489 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    699489 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    699489 (IFNGR2)
   04659 Th17 cell differentiation
    699489 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    699489 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699489 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    699489 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    699489 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    699489 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    699489 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    699489 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    699489 (IFNGR2)
   05140 Leishmaniasis
    699489 (IFNGR2)
   05142 Chagas disease
    699489 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    699489 (IFNGR2)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IFN receptor family
   699489 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac fn3 Interfer-bind
Other DBs
NCBI-GeneID: 699489
NCBI-ProteinID: XP_014988480
Ensembl: ENSMMUG00000005508
UniProt: A0A5F8A6D5
LinkDB
Position
3
AA seq 336 aa
MRPTRLWPLLLGVFAAAAAAPPSDPLSQLPTPQHPKIRLYNAEQVLSWEPVALSNSTRPV
VYRVQFKYTDSEWFMTDIMSIGVNCTQITATECDFTAASPSAGFPMDFNVTLRLRAELGA
LHSAWVTMPWFQHYRNVTVGPPENIEVTPGEGSLIIRFSSPFDIADASTAFFWYYVRYWE
KGGLQQVKGPFRSNSISLDNLKPFRVYCLQVQAQLLWNKSNIFRLGHLSNTSCYETMADA
STELQQVILISVGTFSLLSVLAGACFFLVLKYRGLIKYWFHTPPSIPLQIEEYLKDPTQP
ILEVLDKDSSPKDDVWDSVSIISFPEKEQEDVLQTL
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgcgaccgacgcggctgtggccgctgctgctcggagtcttcgccgccgccgccgccgcg
cccccgtcagaccctctttcccagctgcccacgcctcagcacccgaagattcgcctgtac
aacgcagagcaggtcctgagttgggagccggtggccctgagcaatagcacaaggcctgtt
gtctaccgagtgcagtttaaatacaccgatagtgaatggttcatgaccgacatcatgtcc
ataggggtgaattgtacacagatcacagcaacagagtgtgacttcactgccgccagcccc
tcagcaggcttcccaatggatttcaatgtcactctgcgtcttcgagctgagctgggagca
ctgcattctgcctgggtgacaatgccttggtttcaacactatcggaatgtgactgtcggg
cctccagaaaacattgaggtgaccccaggagaaggctccctcatcatcaggttctcctct
ccctttgacatcgctgatgcctccacagcctttttttggtattatgtccgttactgggaa
aaaggaggactccagcaggtcaaaggccctttcagaagcaactccatttcattggataac
ttaaaacccttcagagtgtactgtttacaagtccaggcacaactgctttggaacaaaagt
aacatctttagactggggcatttaagcaacacatcttgctacgaaacgatggcagatgcc
tccaccgagcttcagcaagtcatcctgatctccgtgggaacattttcgttgctgtcggtg
ctggcaggggcctgtttcttcctggtcctgaaatacagaggcctgattaaatactggttt
cacactccaccaagcattccgttacagatagaagagtatttaaaggacccaacccagccc
atcttagaggtcttggacaaggacagctcaccaaaggatgatgtctgggactctgtgtcc
atcatttcctttccagaaaaggagcaagaagatgttctccaaacactttga

KEGG   Macaca mulatta (rhesus monkey): 699604
Entry
699604            CDS       T01028                                 

Gene name
IFNAR1
Definition
(RefSeq) interferon alpha/beta receptor 1 precursor
  KO
K05130  interferon receptor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    699604 (IFNAR1)
   04151 PI3K-Akt signaling pathway
    699604 (IFNAR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    699604 (IFNAR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    699604 (IFNAR1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    699604 (IFNAR1)
   04621 NOD-like receptor signaling pathway
    699604 (IFNAR1)
   04650 Natural killer cell mediated cytotoxicity
    699604 (IFNAR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    699604 (IFNAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699604 (IFNAR1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    699604 (IFNAR1)
   05160 Hepatitis C
    699604 (IFNAR1)
   05171 Coronavirus disease - COVID-19
    699604 (IFNAR1)
   05164 Influenza A
    699604 (IFNAR1)
   05162 Measles
    699604 (IFNAR1)
   05168 Herpes simplex virus 1 infection
    699604 (IFNAR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    699604 (IFNAR1)
   05169 Epstein-Barr virus infection
    699604 (IFNAR1)
   05165 Human papillomavirus infection
    699604 (IFNAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    699604 (IFNAR1)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IFN receptor family
   699604 (IFNAR1)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 699604
NCBI-ProteinID: NP_001253442
Ensembl: ENSMMUG00000003961
UniProt: H9Z8H4
LinkDB
Position
3
AA seq 558 aa
MMVTLLGATTLVLVTLAPWVLSAAAGGKNLKSPQKVEVDVIDDNFILRWNRSEESVGNVT
FSFDYQKPEMDNWIKLPGCQNMTSTKCNFSSLKLNIYDEIKLRIRAEKENTSSWCEVDSF
TPFRKAQIGPPEVHLEAEDKAIVIYISPPGTEDSVMWALDRSSFTYSLVIWKNSSSVEER
IENIYSRHKISKLSPETTYCLKVKAALLTSRKIGVYGPVHCIKTTVENELPPPENIEVIV
QNQNYVLKWDYTYANMTFQVQWLHAFLKRKPGNHLYKWKQIPDCKNVTTTQCVFPQNTFQ
KGIYLLRVQASDGNNTSFWSEEIKFDTEIQASLLPPVFNIRSLSDSLHISIGAPKWSENK
PVIQDYPLIYEILFWENTSKAERKIIKKKTDVTIPNLKPLTVYCVKARAHSMDEKLNKSS
VFSDVVCEETKSGNTSKIWLIIGIFTVLLALPFVIYAVKVLLRCINYVFFPSLKPSSNID
EYFSEQSLKNLLLSTSEEQIEKCLIIENISTIATVEETNQTDEDHKKYSSQTSEDSGNYS
NEDESENKTSEELQQDFI
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgatggtcaccctcctgggcgcgacgaccctagtgctggtcaccttggcgccatgggtg
ttgtccgcagccgcaggtggaaaaaatctaaaatctcctcaaaaagtagaggttgacgtc
atagatgacaactttatcctgaggtggaacaggagtgaagaatctgtcgggaatgtgact
ttttcattcgattatcaaaaacctgagatggataattggataaaattgcctggatgtcag
aatatgactagtaccaaatgcaacttttcttcgctcaagctgaacatttatgatgaaatt
aaattgcgtataagagcagaaaaagaaaacacttcttcatggtgtgaggttgactcgttt
acaccatttcgcaaagctcaaattggtcctccagaagtacatttagaagctgaagataag
gcaatagtgatatacatctctcctcctggaacagaagatagtgtcatgtgggctttggat
cgttcaagctttacatatagcttagttatctggaaaaactcttcaagtgtagaagaaagg
attgaaaatatttattccagacataaaatttctaaactctcaccagagactacttattgt
ttaaaagttaaagcagcactacttacgtcacggaaaattggtgtctatggtccagtgcat
tgtataaagaccacagttgaaaatgaactacctccaccagaaaatatagaagtcattgtt
caaaatcagaactatgttcttaagtgggattatacgtatgcaaacatgacctttcaagtt
cagtggctccatgcctttttaaaaaggaaacctggaaaccatttgtataaatggaaacaa
atacctgactgcaaaaatgtcacaactacccagtgtgtctttcctcaaaacactttccaa
aaaggaatttaccttctccgcgtacaagcatctgatggaaataacacgtctttttggtct
gaagagataaagtttgatactgaaatacaagcttccctgcttcctccagtctttaacatt
agatcccttagtgattcattacatatctctatcggtgctccaaaatggtctgaaaacaag
cctgtgatccaggattatccactgatttatgaaattcttttttgggaaaacacttcaaag
gctgagagaaaaattatcaagaaaaaaactgatgttactattcctaatttgaaaccactg
actgtatattgtgtgaaagccagagcacacagcatggatgaaaagctgaataaaagcagt
gtttttagtgatgttgtgtgtgaggaaacaaaatcaggaaatacatctaaaatttggctt
ataattggaatttttactgtattacttgctctcccgtttgtcatttatgctgtgaaagtc
ctcttgagatgcatcaattatgtcttctttccatcacttaaaccttcttccaatatagat
gagtatttctctgaacagtcattgaagaatcttctgctttcaacttctgaggaacaaatc
gaaaaatgtcttataattgaaaatataagcacaattgctacagtagaagaaactaatcag
actgatgaagatcataaaaaatacagttcccaaactagcgaagattcaggaaattattct
aatgaagatgaaagtgaaaataaaacaagtgaagaactacagcaggactttatatga

KEGG   Macaca mulatta (rhesus monkey): 699726
Entry
699726            CDS       T01028                                 

Gene name
IFNAR2
Definition
(RefSeq) interferon alpha/beta receptor 2 isoform X1
  KO
K05131  interferon receptor 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04217  Necroptosis
mcc04380  Osteoclast differentiation
mcc04620  Toll-like receptor signaling pathway
mcc04621  NOD-like receptor signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc05160  Hepatitis C
mcc05162  Measles
mcc05164  Influenza A
mcc05165  Human papillomavirus infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    699726 (IFNAR2)
   04151 PI3K-Akt signaling pathway
    699726 (IFNAR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    699726 (IFNAR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    699726 (IFNAR2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    699726 (IFNAR2)
   04621 NOD-like receptor signaling pathway
    699726 (IFNAR2)
   04650 Natural killer cell mediated cytotoxicity
    699726 (IFNAR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    699726 (IFNAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699726 (IFNAR2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    699726 (IFNAR2)
   05171 Coronavirus disease - COVID-19
    699726 (IFNAR2)
   05164 Influenza A
    699726 (IFNAR2)
   05162 Measles
    699726 (IFNAR2)
   05168 Herpes simplex virus 1 infection
    699726 (IFNAR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    699726 (IFNAR2)
   05169 Epstein-Barr virus infection
    699726 (IFNAR2)
   05165 Human papillomavirus infection
    699726 (IFNAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    699726 (IFNAR2)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IFN receptor family
   699726 (IFNAR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 699726
NCBI-ProteinID: XP_001092342
Ensembl: ENSMMUG00000003956
UniProt: A0A5F7ZZD8
LinkDB
Position
3
AA seq 516 aa
MLLSQNAFIVRPLNLFLMVCISLVFGISHDLPDYTSESCTFKISLRNFRSILSWELKNHS
IVATHYKLLYTIMSKPEDLKIVKNCANTTRSFCDLTDEWRSTHEAYVTSLEGFSGNTTLF
NCSHNFWLDIDMSFEPPEFEIVGFTNHINVIVKFPSIVEEELQFDLSLVIEEQSEGIVKK
HKPTIKGNMSGNFTYIIDKLIPNTNYCVSVYFDHNDEQAVIKSPLKCTLLQPGQESESAE
SAKVGGIITVFLIALVLISTIVTLKWIGYICLRNSLPKVLNFHNFLACPFPNLPPLEAMD
IVEVIYINRKKKVWDYNYDDESDSDTEAALRTSGGGYTMHGLTVRPLGQTSATSTESQFT
DPDSEEEPDLPEVDVELPTTPKCSPQRLELLSAPCERRASPLQDPFPEEDYSSTEGSGGR
ITFNVDLNSVFLRVLDDEDSDDLEEAPLMVSSHPEEMVDPEDPDNVQSSHLLASGEGTQP
TFPSPSSEGLQSEDAPSDQSDTSESDVDLGDGYIMR
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgcttttgagccagaatgccttcatcgtcagaccgcttaatttgtttctcatggtgtgt
atcagcctcgtgtttggtatttcacatgatttgcctgattacacaagtgaatcttgcact
tttaagatctcattgcgaaatttccggtccatcttatcatgggaattaaaaaaccactcc
attgtggcaactcactataagttgctgtatacaatcatgagtaaaccagaagatttgaag
atagttaagaactgtgcaaataccacaagatcattttgtgacctcacagatgagtggaga
agcacacacgaggcctatgtcaccagcctagaaggattcagcgggaacacaaccttgttc
aattgctcacacaatttctggctggacatagacatgtcttttgaaccgccagagtttgag
attgttggttttaccaaccacattaatgtgatcgtgaaatttccatctattgttgaggaa
gaattacagtttgatttatcacttgtcattgaagagcagtcagaggggattgttaagaag
cataaacccacaataaaaggaaacatgagtggaaatttcacctatatcattgacaagtta
attccaaacacaaactactgtgtatctgtttatttcgatcataacgatgagcaggcagtc
ataaagtctcccttaaaatgcaccctccttcaacctggccaggaatcagaatcagcagaa
tctgccaaagtaggaggaataattactgtgtttttgatagcgttggtcttgataagcacc
atagtgacactgaaatggattggttatatatgcttaagaaacagcctccccaaagtcttg
aattttcataactttttagcctgcccatttcctaacctgccaccgttggaagccatggat
atagtggaggtcatttacatcaacagaaagaagaaagtgtgggattataattatgatgat
gaaagtgacagtgatactgaggcagcactcaggacaagtggcggtggctataccatgcat
ggactgactgtgaggcctctgggtcagacctccgccacctctacagaatcccagtttaca
gacccagactccgaggaggagcctgacctgcctgaggttgatgtggagctccccacgacg
ccaaagtgcagccctcagcggttggagctcttgagtgcgccctgtgagaggagagcgagt
ccgctccaggacccctttcccgaagaggactacagctccactgaggggtctgggggcaga
attaccttcaatgtggatttaaactctgtatttttgagggttcttgatgacgaggacagt
gacgacttagaagaagctcctctgatggtatcatctcatccggaagagatggttgaccca
gaagatcctgacaatgtgcagtcaagccatttgctggccagtggggaagggacacagcca
acctttcccagcccctcttcagagggcctgcaatctgaagatgctccatctgatcaaagt
gacacttctgagtcagatgttgaccttggggatggttatataatgagatga

KEGG   Macaca mulatta (rhesus monkey): 699869
Entry
699869            CDS       T01028                                 

Gene name
IL7R
Definition
(RefSeq) interleukin-7 receptor subunit alpha
  KO
K05072  interleukin 7 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04068  FoxO signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
mcc05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    699869 (IL7R)
   04068 FoxO signaling pathway
    699869 (IL7R)
   04151 PI3K-Akt signaling pathway
    699869 (IL7R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    699869 (IL7R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    699869 (IL7R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    699869 (IL7R)
  09163 Immune disease
   05340 Primary immunodeficiency
    699869 (IL7R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    699869 (IL7R)
   04090 CD molecules [BR:mcc04090]
    699869 (IL7R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   699869 (IL7R)
CD molecules [BR:mcc04090]
 Proteins
  699869 (IL7R)
SSDB
Motif
Pfam: FN3_7 fn3
Other DBs
NCBI-GeneID: 699869
NCBI-ProteinID: XP_001092582
Ensembl: ENSMMUG00000001676
UniProt: A0A1D5QDM4
LinkDB
Position
6
AA seq 459 aa
MTILGTTFGMVFSLLQVVSGESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFE
DPDVNTTNLEFEICGALVEVKCLSFRKLQEIYFIETKKFLLIGKSNICVKVGGKSLTCKK
IDLTTIVKPEAPFDLSVIYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWMH
VNLSSTKLTLLQRNLQPEAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSPGEMDP
ILLTISLLSFFSVALLVILACVLWKKRIKPIVWPSLPDHKKTLEHLCKKPRKNLNVSFNP
ESFLDCQIHRVDDIQARDEVEGFLQDTFPQQLEESKKQRLGGDVQSPSCPSEDVVITPES
FERDSSLRCLAGNVSACDAPILSSSRSLDCRESGKNGPHVYQDLLLSLGTTNSTLPPPFS
LPSGILTLNPVAQGQPILTSLGSNQEEAYVTMSSFYQNQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgacaattctaggtacaacttttggcatggttttttctttacttcaagtcgtttctgga
gaaagtggctatgcgcaaaatggagacttggaagatgcagaactggatgactactcattc
tcatgctatagccagttggaagtgaatggatcccagcactcactgacctgtgcttttgag
gacccagatgtcaacaccaccaatctggaatttgaaatatgtggggccctcgtggaggta
aagtgcctgagtttcaggaaactacaagagatatatttcattgagacaaagaaattctta
ctgattggaaagagcaatatatgtgtgaaggttggaggaaagagtctaacctgcaaaaaa
atagacctaaccactatagttaaacctgaggctccttttgacctaagtgtcatctatcgt
gaaggagccaatgactttgtggtgacatttaatacatcacacttgcaaaagaagtatgta
aaagttttaatgcacgatgtagcttaccgccaggaaaaagatgaaaacaaatggatgcat
gtgaatttatccagcacaaagctgacactcctgcagagaaacctccaacctgaagcaatg
tatgagattaaagttcgatccatccctgatcactattttaaaggcttctggagtgaatgg
agtccaagttactacttcagaactccagagatcaacaatagcccaggggagatggatcct
atcttactaaccatcagccttttgagttttttctctgtggctctgttggtcatcttggcc
tgtgtgttatggaaaaaaagaattaagcctattgtatggcccagtctccctgatcataag
aagactctggaacatctttgtaagaaaccaagaaagaatttaaatgtgagtttcaatccc
gaaagtttcctggactgccagattcatagggtggatgacattcaagctagagatgaagtg
gaaggttttctgcaagatacgtttcctcagcaactagaagaatctaagaagcagaggctt
ggaggggatgtgcagagccccagctgcccatctgaggatgtggtcatcaccccagaaagt
tttgaaagagattcatccctcagatgcctggctgggaatgtcagtgcatgtgatgcccct
atactctcctcttccaggtccctagactgcagggagagtggcaagaatgggcctcatgtg
taccaggacctcctgcttagccttgggactacaaacagcacactgccccctccattttct
ctcccatccggaatcctgacattgaacccagttgctcaagggcagcccattcttacttcg
ctgggatcaaatcaagaagaagcgtatgtcaccatgtccagcttctaccaaaaccagtga

KEGG   Macaca mulatta (rhesus monkey): 700201
Entry
700201            CDS       T01028                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha isoform X3
  KO
K05056  interleukin 11 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    700201 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    700201 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    700201 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    700201 (IL11RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   700201 (IL11RA)
SSDB
Motif
Pfam: Ig_3 Ig_2 ig EpoR_lig-bind I-set
Other DBs
NCBI-GeneID: 700201
NCBI-ProteinID: XP_014973007
LinkDB
Position
15
AA seq 475 aa
MGQEPPYFTPLLPLASGRSRPHCGGPGREGVEAGAEGEGRGRWRQRPRKMSSGCSGLSRV
LVAVATALVSASSSCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPRLLQGP
DSGLGHELVLTQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCT
WSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQY
RINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGFPRRLRASWTYPASWPRQPH
FLLKFRLQYRPAQHPAWSTVRPGVEPAGLEEMITDAVAGLPHAVRVSARDFLDAGTWSTW
SPEAWGTPSTGTVPKEVPAWGQLHMQPEVEPQVDSPAPPSPSLQPHPRLLDHRDSVEQVA
VLASLGILSFLGLMAGALALGLWLRMRRGGKDGSPKPGFLAPMIPVDRRPGAPNL
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgggccaggagcccccctatttcactcctctccttccattggcgtctgggcggagccgc
ccccactgcgggggcccagggcgggagggagtagaggccggggcagagggcgagggcaga
gggcgctggcggcagcggccgcggaagatgagcagcggctgctcagggctgagcagggtc
ctggtggccgtggctacagccctggtgtctgcctcctcctcctgcccccaggcctggggc
cccccaggggtccagtatgggcagcccggcaggtccgtgaagctgtgttgtcctggagtg
actgctggggacccagtgtcctggtttcgggacggggagccaaggctgctccagggacct
gactctgggctagggcatgaactggtcctgacccaggcagacagcactgatgagggcacc
tacatctgccagacgctggatggtgcacttgggggcacagtgaccctgcagctgggctac
cctccagcccgccctgttgtctcctgccaagcagctgactatgagaacttctcttgcact
tggagtcccagccagatcagcggtttacccacccgctacctcacctcctacaggaagaag
acagttctaggagctgatagccagaggaggagtccatccacagggccctggccatgccca
caggatcccttaggtgctgcccgctgtgttgtccacggggctgagttctggagccagtac
cggattaatgtgactgaggtgaacccactgggcgccagcacacgcctgctggatgtgagc
ttgcagagcatcttgcgccctgacccaccccagggcctgcgggtagagtcggtaccaggt
ttcccccgacgcctgcgagccagctggacataccctgcctcctggccgcgccagccccat
ttcctgctcaagttccgtttgcagtaccgtccggcacagcatccagcctggtccacggtg
aggcctggagtggagccagctggactggaggagatgatcacagatgctgtggctgggctg
ccccatgccgtacgagtcagtgcccgggactttctggatgctggcacctggagcacctgg
agcccggaggcctggggaactccgagcactgggaccgtaccaaaggaggtaccagcttgg
ggccagctacacatgcagccagaggtggagcctcaggtggacagccctgctcctccaagc
ccctccctccaaccacaccctcggctacttgatcacagggactctgtggagcaggtagct
gtgctggcgtctttgggaatcctttctttcctgggactgatggctggagccctggcactg
gggctctggctgaggatgagacggggcgggaaggatggatccccaaagcctgggttcttg
gccccaatgattccagtggacaggcgtccaggagctccaaacctatag

KEGG   Macaca mulatta (rhesus monkey): 700440
Entry
700440            CDS       T01028                                 

Gene name
IL23R
Definition
(RefSeq) interleukin-23 receptor
  KO
K05065  interleukin 23 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    700440 (IL23R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    700440 (IL23R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    700440 (IL23R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700440 (IL23R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    700440 (IL23R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    700440 (IL23R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   700440 (IL23R)
SSDB
Motif
Pfam: IL12p40_C fn3 IL6Ra-bind Lep_receptor_Ig PriX
Other DBs
NCBI-GeneID: 700440
NCBI-ProteinID: XP_028688498
LinkDB
Position
1
AA seq 629 aa
MNQVTIQWDAVIALYILFSWCHGGITNINCSGHIWVEPATIFKMGMNISIYCQAAIKNCQ
PRQLHFYKNGIKERFEITRINKTTARLWYKNFLEPHASMYCTAECPNHFQETLICGKDIS
SGYPPDVPDEVTCVIYEYSGNMTCTWNAGKLTYVDTKYVVHVKSLETEEEQQYLTSSYIN
ISTDSLQGGKKYLVWVQAENALGMEESKQLQIHLDDIVIPSASIISRAETINATVPKTII
YWDSQTTIEKVSCEMRYKATADQTWNVKEFDTNFTYVQQSEFYLEPNIKYIFQVRCQETG
KRYWQAWSSPFFHKTPETVPQVTSKSSQHNTWNSGLTVASISTGHLTSDNREDIGLLLGM
IVFAVMLSILSLIGIFNRSLRTGIKRRILLLIPKWLYEDIPNMKNSNVVKMLQENNELMN
SNSSEQVLYVDPTITEIKEIFIPEHKPTDYKKENTGPLETRDYLQNSLFDNTTVVYIPDL
NTGYKPQISNFLPGRSRLSNNDEITSLTLKPPVDSLDSGNNPRSQKHPNFAFSVSSVNSP
SSTLFLGEVSLILNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGI
MNEELPSINSYFPQSILESHFKRISLLEK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgaatcaggtcactattcaatgggatgctgtaatagccctttacatactcttcagttgg
tgtcatggaggaattacaaatataaactgctctggccacatttgggtagaaccagccaca
atttttaagatgggtatgaatatctctatatattgccaagcagcaattaagaactgccaa
ccaaggcaacttcatttttataaaaatggcatcaaagaaagatttgaaatcacaaggatt
aataaaacaacagctcggctttggtataaaaactttctggaaccacacgcttccatgtac
tgcactgctgaatgtcccaatcattttcaagagacactgatatgtggaaaagacatttct
tctggatatccgccagatgttcctgatgaggtaacctgtgtcatttatgaatattcaggc
aacatgacttgcacctggaatgctgggaagctcacctacgtagacacaaaatacgtggtg
catgtgaagagtttagagacagaagaagagcaacagtatctcacctcaagctatattaac
atctccactgattcattacaaggtggcaagaagtacttggtttgggtccaagcagaaaat
gcactaggcatggaagagtcaaaacaactgcaaattcacctggacgatatagtgatacct
tctgcatccatcatttccagggctgagactataaatgctacagtgcccaagaccataatt
tattgggacagtcaaacaacaattgaaaaggtttcctgtgaaatgagatacaaggctaca
gcagaccaaacttggaatgttaaagaatttgacaccaattttacatatgtgcaacagtca
gaattctacttggagccaaacatcaagtacatatttcaagtgagatgtcaagaaacaggc
aaaaggtactggcaggcttggagttcaccattttttcataaaacacctgaaacagttccc
caggtcacatcaaaatcatcccaacacaacacatggaattctgggctaacagttgcttcc
atctccacaggacaccttacttctgacaacagagaagacattggacttttattgggaatg
atcgtctttgctgttatgttgtcaattctttctctgattgggatatttaacagatcactc
cgaactgggattaaaagaaggatattattgttaataccaaaatggctttatgaagatatt
cctaatatgaaaaacagcaatgttgtgaaaatgctacaggaaaataatgaacttatgaat
agtaattccagtgagcaggtcctatatgttgatcccacgattacagagataaaagaaatc
tttatcccagaacacaagcctacagactacaagaaggagaatacaggacccctggagaca
agagactacctgcaaaactcgctatttgacaatactacggttgtgtatattcctgatctc
aacactggatataaaccccaaatttcaaattttctgcctgggagaagccgtctcagcaat
aatgatgaaatcacttccttaacacttaaaccaccagttgactccttagactcaggaaat
aatcccaggtcacaaaagcatcctaattttgctttttctgtttcaagcgtgaattcacca
agcagcacactatttcttggagaagtaagcctcatattaaatcaaggagaatgcagttct
cctgacatacaaaactcagtagaggaggaaaccaccatgcttttggaaaatgattcaccc
agtgaaactattccagaacagaccctgcttcctgatgaatttgtctcctgtttggggatc
atgaacgaggagttgccatctattaattcttattttccacaaagtattttggaaagccac
ttcaaaaggatttcactcttggaaaagtag

KEGG   Macaca mulatta (rhesus monkey): 700677
Entry
700677            CDS       T01028                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin-12 receptor subunit beta-2
  KO
K05064  interleukin 12 receptor beta-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04658  Th1 and Th2 cell differentiation
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    700677 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    700677 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    700677 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700677 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    700677 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    700677 (IL12RB2)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   700677 (IL12RB2)
SSDB
Motif
Pfam: fn3 Lep_receptor_Ig IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 700677
NCBI-ProteinID: XP_014997464
Ensembl: ENSMMUG00000000651
UniProt: F6X0C8
LinkDB
Position
1
AA seq 863 aa
MAHTFRRCSLALIFITMWLLIKAKIDECKRGDVTVKPSRVILLGSTVNISCSLKPRQGCS
PYSRRNKLILYKFDRRINFHHGHSLNAQVTGLPLGTTLFVCKLACINSDEIQICGAEILV
GVAPEQPQNLSCIQKGEQGTVACTWERGQDTHLYTEYTLQLSGPKNLTWQKQCKDHYCDY
LDFGINLTPESPESNFTAKVTAVNSLGSSSSFPSTFTFLDIVRPLPPWDIRIKFQKASSV
SRCTLYWRDEGLVLLNRLRYRPSNSRHWNMVNVTEARGRHDLLDLKPFTEYEFQISSKLH
LYKGSWSDWSETLRAQTPEEEPTGMLDVWYMKRHIDYSRQQISLFWKNLSVSEARGKILH
YQVTLQELTGGKVMTQNITGHTSWTTVISRTGNWAVAVSAANSKGNSLPTRINIMNLCEA
GLLAPHQVSANSESMDSILVTWQPPRKDLSAVQEYVVEWRQLHPGDDTQIPLNWLRSPPY
NVSALISENIKPYTCYEIRVYALSEDQGGCSSILGNSKHKAPLSGPHINAITEEKGSILI
SWNSIPVQEQMGCLLHYRIYWKERDSNSQPQLCEIPYRVSQNSHPINSLQPRVTYVLWMT
ALTAAGESSQGNEREFCLQGKANWMAFVAPSICVAIIMVGIFSTHYFQQKLSVFLAALRP
QWCSREIPDPANSTCTKKYPTAEEKTQLPLDRLLIDWSMPEDPEPLVISEVLHQVTPIVR
RPHCSNWPQRGKGIQGHQASEKDMMHSASSPPPPRALPAESRQLVDLYKVLESRGSYPKP
ENPASPWTVLPAGNLPTHDGYLPSNIDDLPSHEVPLTDSLEELEPQHISLSVFPSSSLHP
LTFSYGDKLTLDQLKMRCDSLML
NT seq 2592 nt   +upstreamnt  +downstreamnt
atggcacatacttttagacgatgctcactggcacttatttttataaccatgtggctgttg
attaaagcaaaaatagatgagtgcaagagaggcgatgtgactgtgaagccttcccgtgta
attttacttggatccactgtcaatatttcatgttctttgaagcccagacaaggctgctca
ccctattccagacgtaacaagttaatcctgtacaagtttgacagaagaatcaattttcac
catggccactccctcaatgctcaagtcacaggtcttcccctcggtacaaccttgtttgtc
tgcaaactggcctgtatcaatagtgatgaaattcaaatatgtggagcagagatcttagtt
ggtgttgctccagaacagcctcaaaatctatcctgcatacagaagggagaacaagggact
gtggcctgcacctgggaaagaggacaagacacccacctatacactgagtatactctacag
ttaagtggaccaaaaaatttaacctggcagaagcaatgtaaagatcattattgtgactat
ttggactttggaatcaacctcacccctgagtcacctgaatccaatttcacagccaaggtt
actgctgtcaatagtcttggaagctcttcttcatttccatccacattcacattcttggac
atagtgaggcctcttcctccgtgggacattagaatcaaatttcaaaaggcttcctccgtg
agcagatgcaccctttattggagagatgagggactggtactgcttaatcgactcagatat
cggcccagtaacagcaggcactggaatatggttaatgttacagaggccagaggaagacat
gatttgctggatctgaaaccatttacagaatatgaatttcagatttcctctaagctacat
ctttataagggaagttggagtgattggagtgaaacattgagagcacaaacaccagaagaa
gagcctactgggatgttagatgtctggtacatgaaacgacacattgactacagtagacaa
cagatttctcttttctggaagaatctgagtgtctcagaggcaagaggaaaaattctccac
tatcaggtgaccttgcaggagctgacaggagggaaagttatgacacagaacatcacagga
cacacctcctggaccacagtcatttctagaaccggaaattgggctgtggctgtgtctgca
gcaaattcaaaaggcaattctctgcccactcgtattaacataatgaacctgtgtgaggca
gggttgctggctcctcaccaggtctctgcaaactcagagagcatggacagcattctggtg
acttggcagcctcccaggaaagatctctctgctgttcaggagtacgtggtggaatggaga
cagctccatccaggggatgacacacagatccctctaaactggctgcggagtcccccctac
aatgtgtctgctctgatttcagagaacataaaaccctacacctgttatgaaatccgtgtg
tatgcactctcagaggatcaaggaggatgcagctccatcctgggtaactctaagcacaaa
gcaccactgagtggcccccatattaatgccatcacagaggaaaaggggagcattttaatt
tcatggaacagcattccagtccaggagcaaatgggctgcctcctccattacaggatatac
tggaaggaacgggactccaactcccagcctcagctctgtgaaattccctacagagtctcc
caaaattcacatccaataaacagcctgcagccccgagtgacatatgtcctgtggatgaca
gctttgacagctgctggcgaaagttcccaaggaaatgagagggaattttgtctgcaaggt
aaagccaattggatggcgtttgtggcaccaagcatttgcgttgctatcatcatggtgggc
attttctcaacgcattacttccagcaaaagttatctgttttcctagcggccctcagacct
cagtggtgtagcagagaaattccagatccagcaaatagcacttgcactaagaaatatccc
actgcagaggagaagacacagctgcccttggacaggctcctgatagactggtccatgcct
gaagatcctgaacccctggtcatcagtgaagtccttcatcaagtgaccccaattgtcaga
cgtccccactgctccaactggccacaaaggggaaaaggaatccaaggtcaccaggcctca
gagaaagacatgatgcacagtgcctcaagcccaccacctccaagagctctcccagctgag
agcagacaactggtggatctgtacaaggtgctggagagcaggggttcctacccaaagcca
gaaaacccagccagtccctggacggtgctcccagcgggcaaccttcccacccacgatggc
tacttaccctccaacatagatgacctcccctcacatgaggtgcctctcactgactctctg
gaagaactggagcctcagcacatctccctttctgttttcccctcaagttctcttcaccca
ctcaccttctcctatggtgataagctgactctggatcagttaaagatgaggtgtgactcc
ctcatgctctga

KEGG   Macaca mulatta (rhesus monkey): 700959
Entry
700959            CDS       T01028                                 

Gene name
CNTFR
Definition
(RefSeq) ciliary neurotrophic factor receptor subunit alpha precursor
  KO
K05059  ciliary neurotrophic factor receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    700959 (CNTFR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    700959 (CNTFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    700959 (CNTFR)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
    700959 (CNTFR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   700959 (CNTFR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mcc00537]
 Receptors
  700959 (CNTFR)
SSDB
Motif
Pfam: fn3 Ig_3 Ig_5
Other DBs
NCBI-GeneID: 700959
NCBI-ProteinID: NP_001244612
Ensembl: ENSMMUG00000020780
UniProt: H9FPV4
LinkDB
Position
15
AA seq 372 aa
MAAPVPWACCAVLAAAAAVVYTQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLRGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQIPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPVTLAL
AAAATTASSLMI
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgcttgctgctgctgctgcagttgtc
tacacccagagacacagtccacaggaggcaccccatgtgcagtacgagcgcctgggctcc
gacgtgacactgccatgtgggacagcaaactgggatgcagcagtgacgtggcgggtaaat
gggacagacctggcccctgacctgctcaacggctctcagctggtgctccgtggcctggaa
ctgggccacagtggcctgtacgcctgcttccaccgtgactcctggcacctgcgccaccaa
gtcctgctgcatgtgggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacattcccaacacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aaaaaccgctgccacattcgctacatgcacctgttctccaccatcaagtacaaggtctcc
ataagtgtcagcaatgccctgggccacaatgccacagctatcacctttgacgagttcacc
attgtgaagcctgatcctccagaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctggaggtgacatggcagatcccctcgacctggcctgaccctgagtcttttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtct
gatggcacagcacacaccatcacagatgcctacgccgggaaggagtacattatccaagtg
gcagccaaggacaatgaaattgggacatggagtgactggagcgtggctgcccatgctacg
ccctggactgaggaaccgcgacacctcactacagaggcccaggctgcggagaccacgacc
agcaccaccagctccctggcacccccacctaccacgaagatctgtgaccctggggagctg
ggcagcggcgggggaccctcggcacccttcttggtcagcgtccctgtcactctggccctg
gctgccgctgccaccactgccagcagtctcatgatctga

KEGG   Macaca mulatta (rhesus monkey): 704266
Entry
704266            CDS       T01028                                 

Gene name
IL9R
Definition
(RefSeq) interleukin-9 receptor
  KO
K05073  interleukin 9 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    704266 (IL9R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    704266 (IL9R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    704266 (IL9R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    704266 (IL9R)
   04090 CD molecules [BR:mcc04090]
    704266 (IL9R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   704266 (IL9R)
CD molecules [BR:mcc04090]
 Proteins
  704266 (IL9R)
SSDB
Other DBs
NCBI-GeneID: 704266
NCBI-ProteinID: XP_001100521
UniProt: F6UT92
LinkDB
Position
X
AA seq 514 aa
MGLGRCIWKGWTLESEALRRDMGTWLLACTCVCTCVCLGVCVTEEGQGPRAGNFTCLTNN
ILRIDCHWSAPELGQGSSPWLLFTSNQAPGGTHKCILQGSECTVVLPPEAVLVPSDNFTI
TFHHCVSGREQVSLVDPEYLPRRHVKLDPPSDLQSNISSGHCILTWSISPALEPMTTLLN
YELAFKKQEEAWERAQHRDHIVGVTWLVLEAFELDPGFILEARLRVRMATLEDDVAEEER
YTGQWSEWSQPVYFQAPQRQGPLTPPWGQPDNTLVAVSVFLLLIGLTYLLFKLSPRVKRI
FYQNVPSPAAFFRPLYSVHNGNFQTWMGAHRAGVLLSQDCAGAPRGASEPCIQEAIALLT
CGPVHPWKSVALEEEEEGTGTRLAGNLSSENVLPAGCTEWRAQMLAYLPQEDWAPTSPTG
SAPPDSEGSSSSSSDYCTLGCYGGWHLSALPGNTQSPGPIPALACGLSCDHQGLETQQGV
AWVLAGHCQRPGLHEDLQGMVFPSVLSKARSWTF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgggactgggcagatgcatctggaaaggctggaccttggagagtgaagccctgaggcga
gacatgggcacctggctcctggcctgcacctgcgtctgcacctgtgtctgtttgggagtc
tgtgtcacagaggaaggacaagggccaagggctggaaacttcacctgcctcaccaacaac
attctcaggatcgattgccactggtctgccccagagcttggccagggctccagcccctgg
cttctcttcaccagcaaccaggctcccggcggcacacataagtgcatcttgcagggcagt
gagtgcaccgtagtgctgccacccgaggcagtgctcgtgccatccgacaatttcaccatc
actttccaccactgcgtgtctggcagggagcaggtcagcctggtggacccggagtacctg
ccccggagacatgttaaactggacccgccctctgacttgcagagcaacatcagctctggc
cactgcatcctgacctggagcatcagtcctgccttggagccaatgaccacacttctcaac
tatgaattggccttcaagaagcaggaagaggcctgggagcgggcccagcacagggatcac
attgtcggggtgacctggctcgtacttgaagcctttgagctggaccctggctttatcctt
gaggccaggctgcgtgtccggatggccacattggaggatgacgtggcagaggaggagcgt
tacacaggccagtggagtgagtggagccagcctgtgtacttccaggctccccagagacaa
ggccctctgaccccaccctgggggcagccagacaacacccttgtcgctgtgtccgtcttc
ctcctgctgattggcctgacttacctcctgttcaagctttcacccagggtgaagagaatc
ttctaccagaacgtgccctctccagcggcgttcttccggcccctctacagtgtgcacaat
gggaacttccagacttggatgggggcccacagggccggtgtgctgctgagccaggactgt
gctggcgccccacgaggagcctcggagccctgcatccaggaggccattgcactgctaacc
tgtggcccagtgcatccttggaaatctgtggccctggaggaggaagaggagggcactggg
accaggcttgcagggaacctgagctcagagaatgtgctgccagcagggtgtacggagtgg
agggcacagatgcttgcctatctgccacaggaggactgggctcccacgtcccccactggg
tcagctcccccagactcagagggcagcagcagcagcagcagtgactactgtactttgggt
tgctatgggggatggcacctctcagccctcccagggaacacgcagagccctgggcccatc
ccagccctggcttgtggtctttcctgtgaccatcagggccttgagacccagcaaggagtt
gcctgggtgctggctggccactgccagaggcctgggctgcatgaggacctccagggcatg
gttttcccttccgtcctcagcaaggctcggtcctggacgttctag

KEGG   Macaca mulatta (rhesus monkey): 704383
Entry
704383            CDS       T01028                                 

Gene name
IL10RA
Definition
(RefSeq) interleukin-10 receptor subunit alpha
  KO
K05134  interleukin 10 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    704383 (IL10RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    704383 (IL10RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    704383 (IL10RA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    704383 (IL10RA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    704383 (IL10RA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    704383 (IL10RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    704383 (IL10RA)
   04090 CD molecules [BR:mcc04090]
    704383 (IL10RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   704383 (IL10RA)
CD molecules [BR:mcc04090]
 Proteins
  704383 (IL10RA)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 704383
NCBI-ProteinID: XP_028689862
Ensembl: ENSMMUG00000007619
LinkDB
Position
14
AA seq 580 aa
MLPRLVVLLAAFLSRRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVA
LLRYGTGRWNSISNCSQALSYDLTAVTLDLYRSNGYWARVRAVDGSRHSNWTVTNTRFSL
DEVTLTVGSVKLEIHNGFILGKIQPPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTF
THKKVKHENFSLLTSGEVGEFCVQVKPSVTSRTNKGMWSKEECVSLTRQYFTVTNVIIFF
AFVLLLSGALAYCLALQLYVRRRKKLPRVLLFKKPNAFIFISQRPSPETQDTIHPLDEEA
FLKVSPELRNSDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNGEPPELGDSC
SSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSDSRGQDDSGIGLVQNSEGQAGDTQGGS
ALGHDSPPEPEVPAEQDPTAVVFRGYLRQTRCAEEKATKTGCLEEELPLTGGLGPKFRGC
LDDEAGLHPSALAKGYLKQDPLEMTLASSGAPAEQWNQPTEEWSLLALSSCSDLGTSDWS
FAHDLAPLGCVAAPDGLLGSFNSDLVTLPLISSLHSSDSS
NT seq 1743 nt   +upstreamnt  +downstreamnt
atgctcccgcgcctcgtagtgctgctggcggcgttcctcagtcgccgtcttggctcagac
gctcatgggacagagctgcccagcccgccatctgtgtggtttgaagcagaatttttccac
cacatcctccactggacacccatcccaaatcagtctgaaagtacctgctatgaagtggca
ctcctgaggtatggaacagggcgctggaactccatctccaactgtagccaggccctgtcc
tatgaccttaccgcggtgaccttggacctgtaccgcagcaatggctactgggccagagtg
cgtgctgtggacggcagccggcactccaactggaccgtcaccaacacccgcttctctttg
gatgaagtgactctgacagttggcagtgtgaagctagagatccacaatggcttcatcctt
gggaagattcagccccccaggcccaagatggctcctgcaaatgacacatatgaaagcatc
ttcagtcacttccgagagtatgagattgccattcgcaaggtgccgggaaactttacgttc
acacacaagaaagtaaaacatgaaaacttcagcctcctaacctctggagaagtgggagag
ttctgtgtccaggtgaaaccatctgtcacttcccgaactaacaaggggatgtggtctaaa
gaggagtgcgtctccctcaccaggcagtatttcaccgtgaccaacgtcatcatcttcttt
gcctttgtcctgctgctctccggagccctggcctactgcctggccctccagctgtatgtg
cggcgccgaaagaagctgcccagggtcctgctcttcaaaaagcccaacgccttcatcttc
atcagccagcgtccctccccagagacccaagacaccatccacccgcttgatgaggaggcc
ttcctgaaggtgtcaccagagctgaggaactcggacctgcatggcagcacggacagtggc
tttggcagtaccaaaccatccctgcagaccgaagagccccagttcctcctccctgaccct
cacccccaggctgacagaactctgggaaacggagagccccctgagctgggcgacagctgc
agtagtggcagcagcaatagcacagacagcgggatctgcctgcaggagcccagcctgagc
cccagcactgggcccacctgggagcagcaggtggggagcgacagcaggggccaggatgac
agtggcattggcctagttcaaaactctgagggccaggctggggacacacagggtggctca
gccttgggccacgacagtcccccagagcctgaggtgcctgcggaacaagacccaactgct
gtggtattccggggctacctgaggcagaccagatgcgctgaggagaaggcaaccaagaca
ggctgcctggaggaagaattgcccctgacaggtggccttgggcccaaattcaggggatgc
ctggatgacgaagcaggcttgcatccatcagccctggccaagggctatttgaaacaggat
cccctagaaatgactctggcttcctcgggggccccagctgaacagtggaaccagcccact
gaggaatggtcactcctggccttgagcagctgcagtgacctgggaacatctgactggagc
tttgcccatgaccttgcccctctaggctgtgtggcagccccagatggtctcctgggcagc
tttaactcagacctggtcaccctgcccctcatctctagcctgcactcgagtgactcgagc
tga

KEGG   Macaca mulatta (rhesus monkey): 704649
Entry
704649            CDS       T01028                                 

Gene name
IL5RA
Definition
(RefSeq) interleukin-5 receptor subunit alpha
  KO
K05067  interleukin 5 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    704649 (IL5RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    704649 (IL5RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    704649 (IL5RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    704649 (IL5RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    704649 (IL5RA)
   04090 CD molecules [BR:mcc04090]
    704649 (IL5RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   704649 (IL5RA)
CD molecules [BR:mcc04090]
 Proteins
  704649 (IL5RA)
SSDB
Motif
Pfam: IL6Ra-bind Tissue_fac
Other DBs
NCBI-GeneID: 704649
NCBI-ProteinID: XP_028700215
Ensembl: ENSMMUG00000001849
LinkDB
Position
2
AA seq 420 aa
MIIMAPVLLILLGATEILQADLLPDDKISLLPPVNFTIKVTGLAQVLLRWEPNPDQEQRN
VNLEYQVKINAPKEDDYETRITESKCVTILHKGFSASVRTILQKDHSLLASSWASAELHA
PPGSPGTSVVNLTCTTNTTADNYSYLRPYQVSLHCTWLVGTDAPEDTQYFLYYRYGSWTE
ECQEYSKDSMGRNIACWFPRTFIHSRGRDWLAVLVNGSSKHSAIKPFDQLFALHAIDQIN
PPLNVTAEIKGTRLSIQWEKPVSAFPIHCFDYEVKIHNARNGYLQIEKMMTNAFISIIDD
LSKYDVQVRAAVSSMCREAGLWSEWSQPIYVGKDEHKPLRQWFLIVLMATICFILLILLL
ICRICHLWIKLFPPIPAPKSNIKDLFVTANYEKAGSVETEIEVISYIEKPGVETLEDSVF
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgatcatcatggcacctgtattactgatacttttgggggccactgagatactgcaagct
gacttacttcctgatgacaagatttcacttctcccacctgtcaatttcaccattaaagtt
actggtttggctcaagttcttttacgttgggaaccaaatcctgatcaagagcaaaggaat
gttaatctagaatatcaagtgaaaataaacgctccaaaagaagatgattatgaaaccaga
atcactgaaagcaaatgcgtaaccatcctccacaaaggattttcagcaagtgtgcggacc
atcctgcagaaggaccactcactcctggccagcagctgggcttctgctgaacttcatgcc
ccaccagggtctcccggaacctcagttgtgaatttaacttgcaccacaaacactacagca
gataattattcatatttaaggccataccaagtttcccttcactgcacctggcttgttggc
acagatgcccctgaggacacgcagtattttctctactataggtatggctcttggactgaa
gaatgccaagaatacagcaaagactcaatggggagaaatatcgcatgctggtttcccagg
acttttatccacagcagagggcgtgactggcttgcagtgcttgttaacggctccagcaag
cactctgccatcaagccctttgatcagctgtttgcccttcatgccattgatcaaataaat
ccgccactgaatgtcacagcagagattaaaggaactcgtctctctatccaatgggagaaa
ccagtgtctgcctttccaatccattgctttgattatgaagtaaaaatacacaatgcaagg
aacggatatttgcagatagaaaaaatgatgaccaatgcattcatctcaataattgatgat
ctttctaagtatgatgttcaagtgagagcagcagtgagctccatgtgcagagaggcgggg
ctctggagtgagtggagccaacctatttatgtgggaaaagatgaacacaagcccttgaga
cagtggtttctcattgtgcttatggcaaccatctgcttcatcttgttaattctcttgctt
atctgtagaatatgtcatttatggatcaagttgtttccaccaattccagcaccaaaaagt
aatatcaaagatctctttgtaactgctaactatgagaaagctggttccgttgagacagaa
attgaagtcatcagttatatagagaagcctggagttgagaccctggaggattctgtgttt
tga

KEGG   Macaca mulatta (rhesus monkey): 704890
Entry
704890            CDS       T01028                                 

Gene name
IL20RA
Definition
(RefSeq) interleukin-20 receptor subunit alpha isoform X3
  KO
K05136  interleukin 20 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    704890 (IL20RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    704890 (IL20RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    704890 (IL20RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    704890 (IL20RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   704890 (IL20RA)
SSDB
Motif
Pfam: Interfer-bind Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 704890
NCBI-ProteinID: XP_001097436
Ensembl: ENSMMUG00000013566
LinkDB
Position
4
AA seq 442 aa
MSYNGIHQNVFKELKLLTLSSISSQIGPPEVALTTDEKSISVVLTAPEKWKRNPEDLPVS
MQQIYSNLKYNVSVSNTKSNRTWSQCVTNHTLVLTWLEPNTLYCVHVESFVPGPPRRAQP
SEKQCARTLKDQSSEFKAKIIFWYVLPASVTVFLFSVMGYSIYRYIHFGKEKHPANLILI
YGNEFDRRFFVPAEKIMINFITLNISDDSKISHQDMSLLGKSSDVSSLNDPQPSGNLKPP
QEEEEVKHLGYASHLMEIVCDSEENAEGTSLTQQASLSRTIPPDKTVIEYEYDVRTTDIC
AGPEEQELRLQEEVSTQGTLLESQAALALLGPQTLQYSYTPQLQDLDPLTREHTDSEEGP
EEEPSTTLVDWDPQTGRLCIPSLSSFDQDSEGCEPSEGDGLGEEGLLSRLYEEPAPDRPP
GENETYLMQFMEEWGLYVQMEN
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgtcctacaatggaatccaccagaatgtcttcaaggagttaaagttacttacactgtcc
agtatttcatcacaaattggcccaccagaggtggcactgactacagatgagaagtccatt
tctgttgttctaacagctccagagaagtggaagagaaatccagaagaccttcctgtttcc
atgcaacaaatatactccaatctgaagtataacgtgtctgtgtcgaatactaaatcaaat
agaacgtggtcccagtgtgtgaccaaccacacactggtgctcacctggctggagccaaac
actctttactgcgtccacgtggagtccttcgtcccaggtccccctcgccgtgctcagcct
tctgagaagcagtgtgccaggactttgaaagatcaatcatcagagttcaaagctaaaatc
atcttctggtatgttctgcccgcatccgttactgtgtttcttttttctgtgatgggctat
tccatctatcgatacatccacttcggcaaagagaaacacccagcaaatttgattttgatt
tatggaaatgaatttgacagaagattctttgtgcctgctgaaaaaatcatgattaacttt
atcaccctcaatatctcggatgattctaaaatttctcatcaggatatgagtttactggga
aaaagcagtgatgtatccagccttaatgatcctcagcccagcgggaacctgaagccccct
caggaggaagaggaggtgaaacatttagggtatgcctcgcatttgatggaaattgtttgt
gattctgaagaaaacgcagaaggtacttccctcacccagcaagcgtccctcagcagaaca
ataccgccagataaaacagtcattgaatatgaatatgatgtcagaaccactgacatttgt
gcagggcctgaagagcaggagctcaggttgcaggaggaggtgtccacacaaggaacatta
ttggagtcacaggcagcgttggcactcttgggcccgcaaacgttacagtactcatacacc
cctcagctccaagacttagaccccctaacgcgggagcacacagactcagaggaggggcca
gaggaagagccgtcgacgaccctggtcgactgggacccccaaactggcaggctgtgtatt
ccttcgctgtccagcttcgaccaggactcagagggctgcgagccttctgagggggatgga
ctcggggaggagggtcttctgtctaggctctatgaggagccggctccagaccggccacca
ggagaaaatgaaacctatctcatgcaattcatggaggaatgggggttatatgtgcagatg
gaaaactga

KEGG   Macaca mulatta (rhesus monkey): 705404
Entry
705404            CDS       T01028                                 

Gene name
IL4R
Definition
(RefSeq) interleukin-4 receptor subunit alpha isoform X2
  KO
K05071  interleukin 4 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc05200  Pathways in cancer
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    705404 (IL4R)
   04151 PI3K-Akt signaling pathway
    705404 (IL4R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    705404 (IL4R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    705404 (IL4R)
   04658 Th1 and Th2 cell differentiation
    705404 (IL4R)
   04659 Th17 cell differentiation
    705404 (IL4R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    705404 (IL4R)
  09163 Immune disease
   05321 Inflammatory bowel disease
    705404 (IL4R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    705404 (IL4R)
   04090 CD molecules [BR:mcc04090]
    705404 (IL4R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   705404 (IL4R)
CD molecules [BR:mcc04090]
 Proteins
  705404 (IL4R)
SSDB
Motif
Pfam: IL4Ra_N fn3
Other DBs
NCBI-GeneID: 705404
NCBI-ProteinID: XP_014981319
Ensembl: ENSMMUG00000004666
LinkDB
Position
20
AA seq 825 aa
MGWLCSGLLFPVSCLVLLQVASSGSMKVLQEPTCVSDYMSISTCEWKMGGPTNCSAELRL
LYQLVFQSSETHTCVPENNGGVGCVCHLLMDDVVSMDNYTLDLWAGQQLLWKGSFKPSEH
VKPRAPGNLTVHTNVSDTVLLTWSNPYPPDNYLYNDLTYAVNIWSENDLADSRIHNVTYL
KPTLRIPASTLKSGISYRARVRAWAQHYNTTWSEWSPSTKWYNSYREPFEQRLLWGVSAA
CVFILFFCLSCYFSVTKIKKEWWDQIPNPARSHLVAIIIQDAQESQWEKRSRGQEAAKCP
YWKNCLTKLLPCFLEHNMKRDEDPHKAVKDLPFRGSGKSAWCPVEISKTVLWPESISVVR
CVELFEAPVECKEEEEVEEEKGSFCTSSESNRDDFQEGREGIVARLTESLFLDLLGGENG
GFFQQDMGESCLLPPLGSTSAHVPWDEFPSAGPKEVPPWGKEQPLHQEPSPPASPTQSPD
NPTCTEMPLVISSNPAYRSFSNSLSQSPCPRELGPDPLLARHLEEVDPEMPCDPQLSEPT
TVAPAEPETWEQILRRNVLQHGAAAAPASAPTSGYREFVHAVQQGGIQASAVAGLGPPGE
AGYKAFSSLLASSAVSPGECGFGASSGEEGYKPFQDLTPGCPGDPAPVPVPLFTFGLDRE
PPHSPQSSHLPSNSPEHLALEPGEKVEDMQKPPLPPEQATDPLGDNLGSGIVYSALTCHL
CGHLKQCHGQEDGGQAPVVASPCCGCCCGDRSSPPTTPLRAPDPSLGGVPLEASLCPASL
APSGISEKSKSSLSFHPAPGSAQSSSQTPQIVNFVSVGPTCMRVS
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggggtggctttgctctgggctcctgttccctgtgagctgcctggtcctgctgcaggtg
gcaagctctgggagcatgaaggtcctgcaggagcccacctgcgtctctgactacatgagc
atctctacctgtgagtggaagatgggcggtcccaccaattgcagcgccgagctccgtctg
ttgtaccagctggtttttcagtcctccgaaacccacacgtgtgtccccgagaacaacggc
ggtgtggggtgcgtgtgccacctgctcatggatgatgtggtcagtatggacaactatacg
ctggacctgtgggctggacagcagctgctgtggaagggctccttcaagcccagcgagcat
gtgaaacccagggccccaggaaacctcacggttcacaccaatgtctccgacactgtgctg
ctgacctggagcaacccgtatccccctgacaattacctgtataatgatctcacctatgca
gtcaacatttggagtgaaaacgacctggcagattccagaatccataacgtgacctaccta
aaacccaccctccgcatcccagccagcaccctgaagtctggaatttcctacagggcacgg
gtgagggcctgggctcagcactataacaccacctggagtgagtggagccccagcaccaag
tggtacaactcctacagggagcccttcgagcagcgcctcctgtggggtgtcagcgccgcc
tgcgttttcatcctgttcttctgcctgtcgtgctatttcagcgtcaccaagattaagaaa
gaatggtgggaccagattcccaacccagcccgcagccacctcgtggctataataatccag
gatgctcaggagtcacagtgggagaagcgatcccgaggccaggaagcagccaaatgccca
tactggaagaattgtcttaccaagctcttgccctgttttctggagcacaacatgaaaagg
gatgaggatccccacaaggctgtcaaagatctgccattccggggctctggaaaatcagca
tggtgcccggtggagatcagcaagacagtcctctggccagagagcatcagcgtggtgcga
tgcgtggagttgtttgaggctccagtggagtgtaaggaggaggaggaggtagaggaagaa
aaagggagcttctgtacatcatctgagagcaatagggatgacttccaggagggaagggag
ggtattgtggcccggctaacagagagcctgttcctggacctgctcggaggggagaatggg
ggctttttccagcaggacatgggggagtcgtgccttcttccacctttgggaagcacgagt
gctcacgtgccctgggatgagttcccaagtgcagggcccaaggaggtgcctccctggggc
aaggagcagcctctccaccaggagccgagtcctcctgccagcccaacgcagagcccagac
aacccgacttgcacagagatgcccctcgtcatctcaagcaaccctgcttaccgtagcttc
agcaactccctgagccagtccccatgtcccagagagctgggtccagacccgctgctggcc
agacatctggaggaagtggaccctgagatgccctgtgacccccagctctctgagccaacc
actgtggccccagctgagccagaaacctgggagcagatcctccgtcggaatgtcctccag
cacggggcggctgcagcccccgcctcggcccccaccagtggctatcgcgagtttgtacat
gcggtgcagcagggtggcatccaggccagtgcggtggcgggcttgggccccccgggagag
gctgggtacaaggccttctcgagcctgcttgccagcagtgccgtgtccccgggggaatgt
ggatttggggctagcagtggggaagaggggtataagcctttccaagacctcactcctggc
tgccccggggaccctgccccagtccctgtccccttgttcacctttggactggacagggag
ccacctcacagcccgcagagctcacacctcccaagcaactccccagagcacctggctctg
gaaccaggggaaaaagtagaggacatgcaaaagcccccactccccccggagcaggccaca
gacccccttggggacaacctgggcagtggcatcgtctactcagccctcacctgccacctg
tgcggccacctgaagcagtgtcatggccaggaggatggtggccaggcccctgtcgtggcc
agtccctgctgtggctgctgctgtggagacaggtcctcgccccctacaacccccctgagg
gccccagacccctctctaggtggggttccactggaggccagcctctgtccggcctccctg
gcaccctcgggcatctcagagaagagtaaatcctcactgtccttccatcctgcccctggc
agtgctcagagctcaagccagactccccagatcgtgaactttgtctccgtgggtcccaca
tgcatgagggtctcttag

KEGG   Macaca mulatta (rhesus monkey): 705759
Entry
705759            CDS       T01028                                 

Gene name
IL21R
Definition
(RefSeq) interleukin-21 receptor
  KO
K05075  interleukin 21 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
mcc05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    705759 (IL21R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    705759 (IL21R)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    705759 (IL21R)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    705759 (IL21R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    705759 (IL21R)
   04090 CD molecules [BR:mcc04090]
    705759 (IL21R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   705759 (IL21R)
CD molecules [BR:mcc04090]
 Proteins
  705759 (IL21R)
SSDB
Motif
Pfam: IL4Ra_N Phage_holin_T EpoR_lig-bind
Other DBs
NCBI-GeneID: 705759
NCBI-ProteinID: XP_014981321
Ensembl: ENSMMUG00000008252
UniProt: A0A5F7ZB63 A0A5K1ULN0
LinkDB
Position
20
AA seq 538 aa
MLRGWAAPLLLLLLQGGWGCPDLVCYTDYLQTVICILEMWNLHPSTLTLTWQDQYEELKD
EATSCSLHRSAHNATHATYTCHMDVFHFMADDIFSVNVTDHSGNYTQECGSFLLADSIKP
APPFNVTVTFSGQYNISWRSDYEDPAFYMLKGKLQYELQYRNRGDPWAVSPRRKLISVDS
RSVSLLPLEFRKDSSYELQVRAGPMPGSSYQGTWSEWSDPVIFQTQSEELKEGWNPHLLL
LLLLVIVFIPAFWSLKTHPMWRLWKKIWAVPSPEQFFVPLYKGCSGDFKKWVGAPFTGSR
LELGPWSPEVPSALEVYSCHPPQSPAKRLQLTELQEPTELVESDPVSKPSFWATAQNSGG
SAYSEERDRPYGVVSIDTVTVLDAEGPCTWPCSCEDDGYPALDLDAGLEPSPGLEDPLLG
AGTTVLSCGCVSAGSPGLGGPLGSLLDRLKPPLADGEDWAGGLPWGGRSPGGVSESEAGS
PPAGLDMDTFDSGFVGSECSSPVECDFTTPGDEGPPRSYLRQWVVIPPPLSSPGPQAS
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgctgcgtggctgggccgcccccttgctcctgctgctgctccagggaggctggggctgc
cccgacctcgtctgctacaccgattacctccagacggtcatctgcatcctggagatgtgg
aacctccaccccagcacgctcacccttacctggcaagaccagtatgaagagctgaaggac
gaggccacctcctgcagcctccacaggtcggcccacaatgccacgcacgccacctacacc
tgtcacatggacgtattccacttcatggctgacgacattttcagtgtcaacgtcacagac
cactctggcaactacacccaggagtgtggtagctttctcctggctgacagcatcaagccg
gctccccctttcaacgtgactgtgaccttctcaggacagtataatatctcctggcgctca
gattatgaagaccctgctttctacatgctgaagggcaagcttcagtatgagctgcagtac
agaaaccggggagacccctgggctgtgagtccgaggagaaagctgatctcagtggactca
agaagtgtctccctcctccccctggagttccgcaaagactcgagctatgagctgcaggtg
cgggcagggcccatgcctggctcttcctaccaggggacctggagtgagtggagtgatccg
gtcatctttcagacccagtcagaggagttaaaggaaggctggaaccctcacctgctgctt
ctcctcctgcttgtcatagtcttcattcctgccttctggagcctgaagacccacccaatg
tggaggctatggaagaagatatgggccgtccccagccccgagcagttcttcgtgcccctg
tacaagggctgcagcggagacttcaagaagtgggtcggtgctcccttcactggctccagg
ctggagttgggaccctggagcccagaagtgccctcagccctggaggtgtacagctgccac
ccaccacagagccccgccaagaggctgcagctcacggagctacaagaaccaacagagctg
gtggagtctgaccccgtgtccaagcccagcttctgggcgacggcccagaactcaggaggc
tcagcttacagtgaggagagggaccggccgtacggcgtggtgtccatcgatacagtgact
gtgctagatgcagaggggccatgcacctggccctgcagctgtgaggatgacggctaccca
gccctggacctggacgctggcctggagcccagcccaggcctagaggatccactcttgggc
gcgggaaccacagtcctctcctgtggctgtgtctcagctggcagccctgggctaggagga
cccctgggaagcctcctggacagactaaagccaccccttgcagatggggaggactgggct
gggggactgccctggggtggccggtcgcccggaggggtctcagagagtgaggcgggctca
cccccggctggcctggatatggacacgtttgacagtggcttcgtgggctctgagtgcagc
agccctgtggagtgtgacttcaccacccccggggacgaagggcccccccggagctacctc
cgccagtgggtggtcattcccccgccactttcgagccctggaccccaggccagctag

KEGG   Macaca mulatta (rhesus monkey): 706012
Entry
706012            CDS       T01028                                 

Gene name
IL10RB
Definition
(RefSeq) interleukin-10 receptor subunit beta isoform X2
  KO
K05135  interleukin 10 receptor beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    706012 (IL10RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    706012 (IL10RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    706012 (IL10RB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    706012 (IL10RB)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    706012 (IL10RB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    706012 (IL10RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    706012 (IL10RB)
   04090 CD molecules [BR:mcc04090]
    706012 (IL10RB)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   706012 (IL10RB)
CD molecules [BR:mcc04090]
 Proteins
  706012 (IL10RB)
SSDB
Motif
Pfam: Interfer-bind Tissue_fac fn3
Other DBs
NCBI-GeneID: 706012
NCBI-ProteinID: XP_014988486
UniProt: H9FU05
LinkDB
Position
3
AA seq 325 aa
MARSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYR
IFQDKCTSTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVQGFLPDRNKTGEWSEPVCEKTTSDETVPSWMVAIILMASVFVVCLALLG
CFALLWCIYKKTKYTFSPGNSLPQHLKEFLGHPHHNTLLFFSFPFSDENDVFDKLSVIAE
DSESSKQNPDDSCSLGTPSGQGPQS
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgcggagcctcgggagctggctgggcggctgcctgctggtgtcagcattaggaatg
gtaccacctcctgaaaatgtcagaatgaattctgttaatttcaagaacattctacagtgg
gagtcacctgcttttgccaaagggaacctgactttcacagctcagtacctaagttatagg
atattccaagataaatgcacgagtactaccttgacggaatgtgatttctcaagtctttcc
aagtatggtgaccacaccttgagagtcagggctgaatttgcagatgagcattcagactgg
gtaaacatcaccttctgtcctgtggatgacaccattattggaccccctggaatgcaagta
gaagtacttgctgattctttacatatgcgtttcttagcccctaaaattgaaaatgaatac
gaaacttggactatgaagaatgtgtataattcatggacttataatgtgcaatattggaaa
aatggtactgatgaaaagtttcaaattactcctcagtatgactttgaggtcctcagaaac
ctggagccatggacaacttattgtgttcaagttcaagggtttcttcctgatcggaacaaa
actggggaatggagtgagcctgtctgtgagaaaacaaccagtgatgagacggtcccctcc
tggatggtggccatcatcctcatggcctcggtcttcgtggtctgcctggcactccttggc
tgcttcgccttgctgtggtgcatttataagaagacaaagtacaccttctcccctgggaat
tctcttccacagcacctgaaagagtttttgggccatcctcatcataacacacttctgttt
ttctcctttccattctcggatgagaatgatgtttttgacaagctaagtgtcattgcagaa
gactctgagagcagcaagcagaatcctgatgacagctgcagcctcgggaccccgtctggg
cagggaccccagagctag

KEGG   Macaca mulatta (rhesus monkey): 708339
Entry
708339            CDS       T01028                                 

Gene name
IL13RA2
Definition
(RefSeq) interleukin-13 receptor subunit alpha-2
  KO
K05077  interleukin 13 receptor alpha-2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    708339 (IL13RA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    708339 (IL13RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    708339 (IL13RA2)
   04090 CD molecules [BR:mcc04090]
    708339 (IL13RA2)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   708339 (IL13RA2)
CD molecules [BR:mcc04090]
 Proteins
  708339 (IL13RA2)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 708339
NCBI-ProteinID: XP_014983540
Ensembl: ENSMMUG00000022224
UniProt: F6Z890
LinkDB
Position
X
AA seq 388 aa
MDFVYLAIRCLCTFLISTTFGYTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
NFKECTVEYELKYRNIGSETWTTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAEATYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDR
ALQCVDYIKVDGQNIGCRFPYLESSDYKDFYICVNGSSETKPIRSSYFTFQLQNIVKPLP
PVCLTCTQESLYEIKLKWSIPLGPIPARCFVYEIEIREDDTTLVTTTVENETYTLKITNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEVEELLKKTLLLFLLPFGFILILVIFVTG
LLLCKRDSYPKMNFSVIDEDFPYQETWY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggatttcgtctacttggctatcagatgcttatgtacctttctgataagcacaacattc
ggctatacttcatcttcagacaccgagataaaagttaaccctcctcaggattttgagata
gtggatcccggatatttaggttatctctatttgcaatggcaacccccactgtctctggat
aattttaaggaatgcacagtggaatatgaactaaaataccgaaacattggtagtgaaaca
tggacgaccatcattactaagaatctacattacaaagatgggtttgatcttaacaagggc
attgaagcaaagatacacacacttttaccatggcaatgcacaaatggatcagaagttcaa
agttcctgggcagaagctacttattggatatcgccacaaggaattccagaaactaaagtt
caggatatggattgtgtatattacaattggcaatatttactctgttcttggaaacctggc
ataggtgtacttcttgataccaattacaacttgttttactggtatgagggcttggatcgt
gcattacagtgtgttgattacatcaaggttgatggacaaaatattggatgcagatttccc
tatttggagtcatcagactataaagatttctacatttgtgttaatggatcatcagaaacc
aagcctatccgatccagttatttcacttttcagcttcaaaatatagttaaacctttgccg
ccagtctgtcttacttgtactcaggagagtttatatgaaattaagctgaaatggagcata
cctttgggacctattccagcaaggtgttttgtttatgaaattgagatcagagaagatgat
actaccttggtgactaccacagttgaaaatgaaacgtacaccttgaaaataacaaatgaa
acccgacagttatgctttgtagtaagaagcaaagtgaatatttattgctcagatgatgga
atttggagtgagtggagtgataaacaatgttgggaagttgaagaactattgaagaaaact
ttgctacttttcttgttaccatttggtttcatattaatattagttatatttgtaaccggt
ctgcttttgtgtaagagagacagctacccgaaaatgaatttttctgtgatagatgaagac
tttccatatcaagagacatggtattga

KEGG   Macaca mulatta (rhesus monkey): 710986
Entry
710986            CDS       T01028                                 

Gene name
IL13RA1
Definition
(RefSeq) interleukin-13 receptor subunit alpha-1
  KO
K05076  interleukin 13 receptor alpha-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    710986 (IL13RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    710986 (IL13RA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710986 (IL13RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    710986 (IL13RA1)
   04090 CD molecules [BR:mcc04090]
    710986 (IL13RA1)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL3 receptor family
   710986 (IL13RA1)
CD molecules [BR:mcc04090]
 Proteins
  710986 (IL13RA1)
SSDB
Motif
Pfam: Il13Ra_Ig IL6Ra-bind fn3 EpoR_lig-bind LIFR_D2 LIFR_N
Other DBs
NCBI-GeneID: 710986
NCBI-ProteinID: XP_014983563
UniProt: I0FRG9
LinkDB
Position
X
AA seq 425 aa
MERPARLCGLWALLLCAGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASPNC
SLWYFSHFGDKQDKKLAPETRRSKEVPLNEKICLQVGSQCSTNESEKPSILVEKCISPPE
GDPESAVTELQCIWHNLSYMQCSWLPGRNTSPDTNYTLYYWHRSLEKIRQCEEIYKEGQY
FGCSFDLTKVKDSSFEQHSVQIMVKDYAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNGD
LHVQWENPQNFISRCLFYEVEVNNSQTETHNVFSVQEAKCQNPEFERNVENTSCFMVPGV
LPDTLNTVRIRVKTNKLCYEDDKLWSNWSQEMSIGKKRNSTLYITMLLIVPVIVAGAIIV
LLLYLKRLKIIIFPPIPDPGKIFKEMFGDQNDDTLHWKKYDIYEKQTKEETDSVVLIENL
KKASQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagcggccggcgcggctctgcgggctgtgggcgctgctgctctgcgccggcggcggg
ggcgggggcgccgcgcccacggaaactcaaccacctgtgacaaatttgagtgtctctgtt
gaaaacctctgcacagtaatatggacatggaatccacccgagggagccagcccaaattgt
agtctatggtattttagtcattttggcgacaaacaagataagaaactagctccagaaact
cgtcgttcaaaagaagtgcccctgaatgagaagatttgtctgcaagtggggtcccagtgt
agcaccaatgaaagtgagaagcctagcattttggttgaaaaatgcatctcgccccctgaa
ggtgatcctgagtccgctgtgactgagcttcaatgcatttggcacaacctgagctacatg
cagtgttcttggctccctggaaggaataccagtcccgacactaactatactctctactat
tggcacagaagcctggaaaaaattcgtcaatgtgaagagatctataaagaaggccaatac
tttggttgttcctttgatctgaccaaagtgaaggattccagttttgaacaacacagtgtg
caaataatggtcaaggattatgcaggaaaaattaaaccatccttcaatatagtgccttta
acttcccgtgtgaaacctgatcctccacatattaaaaacctctccttccacaatggtgac
ctacatgtacaatgggagaatccacagaattttattagcagatgcttattttatgaagta
gaagtcaataacagccaaaccgagacacataatgttttctccgtccaagaggctaaatgt
cagaatccagaatttgagagaaatgtggagaatacatcttgtttcatggtccctggtgtt
cttcctgatactttgaacacagtcagaataagagtcaaaacaaataagttatgctatgag
gatgacaaactctggagtaattggagccaagaaatgagtataggtaagaagcgcaattcc
acactctacataaccatgttactcattgttccagtcatcgttgcaggtgcaatcatagta
cttctgctttacctaaaaaggctcaagatcattatattccctccaattcctgatcctggc
aagatttttaaagaaatgtttggagaccagaatgatgatactctgcactggaagaagtat
gacatctatgagaagcaaaccaaggaggaaaccgactctgtagtgctgatagaaaacctg
aagaaagcctctcagtga

KEGG   Macaca mulatta (rhesus monkey): 711059
Entry
711059            CDS       T01028                                 

Gene name
IL22RA2
Definition
(RefSeq) interleukin-22 receptor subunit alpha-2 isoform X1
  KO
K05139  interleukin 22 receptor alpha 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711059 (IL22RA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    711059 (IL22RA2)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   711059 (IL22RA2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind SCPU
Other DBs
NCBI-GeneID: 711059
NCBI-ProteinID: XP_014992847
Ensembl: ENSMMUG00000013562
LinkDB
Position
4
AA seq 231 aa
MMPKHCFLGFLISFFLTGVAGTQPAHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVY
FVQYKIYGQRQWKNKEDCWGTQELFCDLTSETSDIQEPYYGRVRAASAGSYSDWSMTPRF
TPWWETKIDPPVMNITQVNGSLLVILHAPNLPQRYQKEKNISIEDYYELVYRVFIINNSL
EKEQKVYEGAHRVVEIEALPPHSSYCVVAEIYQPMLDRRSQRSEERCVEMP
NT seq 696 nt   +upstreamnt  +downstreamnt
atgatgcctaaacattgctttctaggcttcctcatcagtttcttccttactggtgtagca
ggaactcagccagcacatgagtctctgaagcctcagagggtacaatttcagtcccgaaat
tttcacaacattttgcaatggcagcctgggagggcacttactggcaacagcagtgtctat
tttgtgcagtacaaaatatatggacagagacaatggaaaaataaggaagactgttggggt
actcaagaactcttttgtgaccttaccagtgaaacctcagacatacaggagccttattac
gggagggtgagggcggcctcggctgggagctactcagactggagcatgacgccgcggttc
actccctggtgggaaacaaaaatagatcctccagtcatgaacataacccaagtcaatgga
tctttgttggtaattctccatgctccaaatttaccacaaagataccaaaaggaaaaaaat
atatctatagaagattactatgaactagtataccgagtttttataattaacaattcacta
gaaaaggagcaaaaggtttatgaaggggctcacagagttgttgaaattgaagctctacca
ccacattccagctactgtgtagtggctgaaatatatcagcccatgttagacagaagaagt
cagagaagtgaagagagatgtgtggaaatgccatga

KEGG   Macaca mulatta (rhesus monkey): 711353
Entry
711353            CDS       T01028                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04540  Gap junction
mcc04630  JAK-STAT signaling pathway
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05206  MicroRNAs in cancer
mcc05214  Glioma
mcc05215  Prostate cancer
mcc05218  Melanoma
mcc05230  Central carbon metabolism in cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    711353 (PDGFRB)
   04014 Ras signaling pathway
    711353 (PDGFRB)
   04015 Rap1 signaling pathway
    711353 (PDGFRB)
   04630 JAK-STAT signaling pathway
    711353 (PDGFRB)
   04020 Calcium signaling pathway
    711353 (PDGFRB)
   04072 Phospholipase D signaling pathway
    711353 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    711353 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    711353 (PDGFRB)
   04540 Gap junction
    711353 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    711353 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711353 (PDGFRB)
   05206 MicroRNAs in cancer
    711353 (PDGFRB)
   05230 Central carbon metabolism in cancer
    711353 (PDGFRB)
   05231 Choline metabolism in cancer
    711353 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    711353 (PDGFRB)
   05218 Melanoma
    711353 (PDGFRB)
   05215 Prostate cancer
    711353 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    711353 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    711353 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mcc01001]
    711353 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mcc04090]
    711353 (PDGFRB)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     711353 (PDGFRB)
Protein kinases [BR:mcc01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   711353 (PDGFRB)
CD molecules [BR:mcc04090]
 Proteins
  711353 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 711353
NCBI-ProteinID: XP_001107595
Ensembl: ENSMMUG00000011557
UniProt: F7BTH1
LinkDB
Position
6
AA seq 1106 aa
MRLPGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELILNVSSTFVLTCSGSAPV
VWERMSQELPQEMAKAQDNTFSSVLTLTNLTGLDTGEYFCTYNDSRGLEPDERKRLYIFV
PDPTMGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWMYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDMQEVIVVPHSLPFKAVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDSSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLERQV
EPEPELEQLPDSGCPAPRAEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttccgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctgctgttactgctggaaccgcaggtctctcagggcctggtcatcacacccccggggcca
gagcttatcctcaatgtctccagcacctttgttctgacctgctcgggttcagctcccgtg
gtgtgggagcggatgtcccaggagctcccacaggaaatggccaaggcccaggacaatacc
ttctccagtgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acctacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccaccatgggcttcctccctaatgacgccgaggaactattcatctttcttacg
gaaataactgagatcaccattccatgccgagtaacagacccacaactggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctacgatcaccagcgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgacgcctactatgtctacagactccaggtgtcatccatcaacgtctccgtgaatgca
gtgcagacggtggtccgccagggtgagaacattaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggatgtacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacagagagtgtgaatgaccat
caggatgaaaaggccatcaacatcactgtggttgagagtggctacgtgcggctcctggga
gaggtgggagcactacaatttgctgagctgcaccggagccggacactgcaggtagtgttc
gaggcctaccctccgcccaccgtcctgtggttcaaagacaaccgcaccttgggcgactcc
agcgcaggcgagatcgccctgtccacgcgcaacgtgtcagagaccaggtatgtgtcagag
ctgacactcgttcgggtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgcgtgctg
gagctaagtgagagccacccagacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtctgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccatgctgctggggaacagttctgaagaggagagccagctggagacgaacgtg
acatactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccactgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacatgcaggag
gtcatcgtggtgccacactctttgcccttcaaggcggtggtgatctcagccatcctggcc
ctggtggtcctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgatggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaagcacacgttc
ctgcagcaccattccgacaagcgccgcccgcccagcgcggagctctacagcaatgcgttg
cccgttgggctccccctgcccagccacgtgtccctgactggggagagcgatggtggctac
atggacatgagcaaggacgagtcggtggactacgtgcccatgctggacatgaaaggagat
gtcaaatatgccgacatcgagtcctccaactacatggccccctacgataactacgttccc
tctgcccctgagaggacctgtcgagcaactttaatcaatgagtctccggtgctaagctac
atggaccttgtgggcttcagctaccaggtggccaatggcatggagttcctggcctccaag
aactgcgtgcaccgagacctggcggccaggaacgtgctcatctgcgagggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggattcgaattacatctccaaa
ggcagtacctttttgcctttgaagtggatggctccagagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcactttgggt
ggcaccccttacccagagctgcccatgaatgagcagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccacgcctccgacgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccctttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacagcagctccgtcctctataccgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcctgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcgaccatctcctgt
gacagccctctggagccccaggaggaaccagagccagagccccagcttgagcgccaggtg
gaaccagagccagagctggaacagctgccggattcagggtgccccgcgcctcgagcggaa
gcagaggacagcttcctgtag

KEGG   Macaca mulatta (rhesus monkey): 711625
Entry
711625            CDS       T01028                                 

Gene name
IFNLR1
Definition
(RefSeq) interferon lambda receptor 1 isoform X1
  KO
K05140  interferon lambda receptor 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    711625 (IFNLR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    711625 (IFNLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    711625 (IFNLR1)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   711625 (IFNLR1)
SSDB
Motif
Pfam: Tissue_fac Ribosomal_60s
Other DBs
NCBI-GeneID: 711625
NCBI-ProteinID: XP_014986729
Ensembl: ENSMMUG00000023057
LinkDB
Position
1
AA seq 526 aa
MAGPERWGPLLLCLLQAAPGRPRLAPPQNVTLLSRNFSVYLTWLPGLGNPQDVTYFVAYQ
SSPTPRRWRKVEECAGTKELLCSMMCLKKQDLYNKFKGRVQTVSPSSKSPWVESEYVDYL
FEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQ
PVRITLQPAASERHCLSARTIYTFSVPKYSEFSKPTCFLLEVPEASWAFLVLPSLLILLL
VIAAGGVIWKSLMGNPWFQRAKMPRALDFSGHTYPVATFQPSRPESLNDLLLCPQKELTR
GVRLTPRVRAPATQQAGWKKDLAEDEDEEEEEEEEDTEDGVSFQPYIEPPSFLGQEHQVP
GHSEVGGVDSGRPRAPLLPGEGSSAWDSSDRSWASTVDSSWDRAGSSGYLAEKGPGQGPG
GDGHQEPLPPPEFSTDSGFLEELPKDDLSSWATWGTLPPESNLVPGGPPVSLRTLTFCWE
SSLEEEEEEEEARESETEDSDAGSWGAESTQRTEERGRTRGYYMAR
NT seq 1581 nt   +upstreamnt  +downstreamnt
atggcggggcccgagcgctggggccccctgctcctgtgcctactgcaggccgctccaggg
aggccccgtctggcccctcctcagaatgtgacgctgctctcccggaacttcagcgtgtac
ctgacgtggctcccagggcttggcaacccccaggatgtgacctattttgtggcctatcag
agctctcccacccccagacggtggcgcaaagtggaagagtgtgcaggaaccaaggagctg
ctgtgttctatgatgtgcctaaagaaacaggacctgtacaacaagttcaaggggcgcgtg
cagacggtttctcccagctccaagtccccctgggtggagtccgaatatgtagattacctt
tttgaagtggagccggccccacctgtcctggtgctcacccagacggaggagatcctaagt
gccaatgccacataccagctgcccccctgcatgcctccactggatctgaagtatgaggtg
gcattctggaaggagggggccggaaacaagaccctatttccagtcactccccatggccag
ccagtccggatcaccctccagccagctgccagcgaacgccactgcctcagtgccagaact
atctacaccttcagtgtcccgaaatacagcgagttctctaagcccacgtgcttcttgctg
gaggttccagaagccagctgggctttcctggtgctgccatcacttctgatactgctgtta
gtaattgctgcagggggtgtgatctggaagagcctcatggggaacccctggtttcagcgg
gcaaagatgccacgggccctggacttttctggacacacataccctgtggcaacctttcag
cccagcagaccagagtccctgaacgacttactcctctgtccccaaaaggaactgaccaga
ggggtcaggctgacgcctagagtcagggccccagccactcaacaggcaggatggaagaag
gaccttgcagaggacgaggacgaggaggaggaggaggaggaggaggacacagaagatggc
gtcagcttccagccctacattgagccaccttctttcctggggcaagagcaccaggttcca
gggcactcggaggttggtggggtggactcagggaggcccagggctcctctgctcccgggc
gaaggctcctctgcttgggattcttcagacagaagctgggccagcactgtggactcctcc
tgggacagggctggatcctctggctatttggctgagaaggggccaggccaagggccgggt
ggggacgggcaccaagaacctctcccaccacctgaattctccacggactcgggtttcctg
gaagagctcccaaaagatgacctctcctcctgggccacctggggcaccttaccaccagag
tcaaatctggtccctggggggcccccagtttctcttcggacactgaccttctgctgggaa
agcagccttgaggaggaagaggaggaagaggaggcgagggaatcagaaactgaggacagc
gatgcgggcagctggggggctgaaagcacccagaggaccgaggagaggggccggacacgg
gggtattacatggccaggtga

KEGG   Macaca mulatta (rhesus monkey): 712788
Entry
712788            CDS       T01028                                 

Gene name
IL15RA
Definition
(RefSeq) interleukin-15 receptor subunit alpha isoform 2 precursor
  KO
K05074  interleukin 15 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04672  Intestinal immune network for IgA production
mcc05166  Human T-cell leukemia virus 1 infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    712788 (IL15RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    712788 (IL15RA)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    712788 (IL15RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    712788 (IL15RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    712788 (IL15RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    712788 (IL15RA)
   04090 CD molecules [BR:mcc04090]
    712788 (IL15RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL2 receptor family
   712788 (IL15RA)
CD molecules [BR:mcc04090]
 Proteins
  712788 (IL15RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 712788
NCBI-ProteinID: NP_001072985
Ensembl: ENSMMUG00000015149
UniProt: A0MSN2
LinkDB
Position
9
AA seq 233 aa
MAPRRARGSRTLGLPALLLLLLLRPPATRGITCPPPVSVEHADIRVKSYSLYSRERYICN
SGFKRKAGTSSLTECVLNKATNIAHWTTPSLKCIKPAASSPSSNTTAATTAAIVPSSRLM
PSTSSSTGTTEIGSHESSHGPSQTTAKTWELTASASHQPPGVYPQGHSDTTVAISTSTVL
LCGLSAVSLLACYIKSRQTPPPASIEMEAMEALPVTGETSSRDEDLENCSHDL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggccccgcggcgggcgcgcggctcccggaccctcggcctcccggcgctgctgctgctg
ctgctgctccgaccgccagcgacgcggggcatcacgtgccctcccccagtgtccgtggaa
cacgcagacatccgggtcaagagctacagcttgtactccagggagcggtacatttgtaac
tctggtttcaagcgtaaagccggcacgtccagcctgactgagtgcgtgctgaacaaggcc
acgaacatcgcccactggacaacccccagtctcaaatgcattaagcctgcagcttcatct
cccagctcaaacaccacagcggccacaacagcagctattgtcccgagctcccggctgatg
ccttccacatcgtcttccacaggaaccacagagataggcagtcatgagtcctcccacggc
ccctctcagacaacagccaagacctgggaactcacggcatccgcctcccaccagccgcca
ggtgtgtatccacagggccacagcgacaccactgtggctatctccacatccaccgtcctg
ctgtgtggactgagcgctgtgtctctcctggcatgctacatcaagtcaaggcaaactccc
ccgccggccagcattgaaatggaagccatggaggctctgccggtgactggggagaccagc
agcagagatgaagacttggaaaactgctctcacgacctctga

KEGG   Macaca mulatta (rhesus monkey): 713485
Entry
713485            CDS       T01028                                 

Gene name
CSF3R
Definition
(RefSeq) granulocyte colony-stimulating factor receptor isoform X1
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    713485 (CSF3R)
   04151 PI3K-Akt signaling pathway
    713485 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    713485 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    713485 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    713485 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    713485 (CSF3R)
   04090 CD molecules [BR:mcc04090]
    713485 (CSF3R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  Prolactin receptor family
   713485 (CSF3R)
CD molecules [BR:mcc04090]
 Proteins
  713485 (CSF3R)
SSDB
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind IL6Ra-bind fn3_2 ObR_Ig
Other DBs
NCBI-GeneID: 713485
NCBI-ProteinID: XP_014990976
Ensembl: ENSMMUG00000020434
UniProt: F6TU14
LinkDB
Position
1
AA seq 836 aa
MARLRTCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDLEPQ
ILWRLGAELQPGGRQQRLSDGSQQSTITLPHLNHTRAFLSCCLNWGNSLQILDQVELRAG
YPPAVPRNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSIMDCVPE
DGQSHCSIPRRHLLLYQNMGIWVQAENALGTSMSPQLCLEPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPALHINQKCELRHKPQSGEASWALVGPLPLEALRYELCGLLPA
TAYTLQIRCIRWPLPGHWSNWSPSLELRTTERAPAVRLNTWWRQRQLDPRTVQLFWKPVP
LEEDSGQIQGYVVSWRPSGQAGAILPLCNTTELSCTFPLPSEAQEVALVAYNSAGTSCPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPSPWPRGYVIEWGLSPPSTSNSNKTWRME
QNGSATGFLLQENIRPFQLYEITVTPLYQDAMGPSQHVYAYSQEMAPRHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSTILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNGTVLTLMTLIPEGSELHILLGLFGLLLLLSCLCGTAWLCCSPSRKNPLWP
SVPDPAHSSLGSWVPTIMEEEAFQLPGLGMPPITKLTVLEEDEKKPLPWESHNSSETCGL
PTLVQTYVLQGDLRAASAQPQSQSGTSNQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLDFPLLQGIRVHGVEGLESF
NT seq 2511 nt   +upstreamnt  +downstreamnt
atggcaaggctgagaacctgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacctggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctctctgat
gggagccagcaatctaccatcaccctgccccacctcaaccacactcgggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagctgtaccccgcaacctctcctgcctcatgaacctcacaaccagcagcctc
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagc
ttcaagagccggggcaactgtcagacccaaggggattccatcatggactgcgtgcccgaa
gacgggcagagccactgctccatcccacgcagacacctgctgttgtaccagaatatgggc
atctgggtgcaggcggagaatgcgctggggaccagcatgtccccacaactgtgccttgag
cccatggacgtcgtgaaactggagccccccatgctgcggaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagttgtgctgggagccatggcagccagccctg
cacataaatcagaagtgtgagctgcgccataagccacagagtggagaagccagctgggca
ctggtgggccccctgccgttggaggcccttcggtatgagctctgtgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcctctgcctggccactggagcaac
tggagtcccagcctggagctgagaactactgaacgggcccccgctgtcagactgaacaca
tggtggcggcagaggcagctggacccccggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacagatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccccctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctcctgtcccacc
ccagtggtcttctcagagagcagaggcccagccctgaccagactccatgccatggcccga
gaccctcacagcctctgggtgggctgggagccccccagtccatggcctcggggctatgtg
attgagtggggcctgagcccccccagcacgagcaatagcaacaagacctggaggatggaa
cagaacgggagcgccacggggtttctgctgcaggagaacatcaggccctttcagctctat
gagatcactgtgactcccttgtaccaggacgccatgggaccctcccagcatgtctatgcc
tactcccaagaaatggccccccgccatgccccagagctgcatctaaagcacattggcaag
acctgggcacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaatgctcaaaaccagtcgttctccaccatcctgaatgcc
tcttcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacattcacctc
atggctgccagccaggccggcgccaccaatggtacagtcctcaccctgatgaccttgatc
ccagagggatccgagctacacatcctcctgggcctgttcggcctcctgctcttgctctcc
tgcctctgtggaactgcctggctctgctgcagccccagcaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctgggctcctgggtgcccactatcatggaagag
gaggccttccagctgcctggcctgggcatgccacccatcaccaagctcacagtgctggag
gaggacgagaagaagccactgccctgggagtcccataacagctcagagacctgtggcctc
cccactctggtccagacctatgtgctccagggggacctaagagcagcttccgcccagccc
caatcccagtccggcaccagcaatcaggtcctctacgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgcgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccctggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcgacttcccc
ctcctgcaggggatccgagtccatggggtggaggggctggaaagcttctag

KEGG   Macaca mulatta (rhesus monkey): 714546
Entry
714546            CDS       T01028                                 

Gene name
EPOR
Definition
(RefSeq) erythropoietin receptor
  KO
K05079  erythropoietin receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    714546 (EPOR)
   04151 PI3K-Akt signaling pathway
    714546 (EPOR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    714546 (EPOR)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    714546 (EPOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714546 (EPOR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    714546 (EPOR)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  Prolactin receptor family
   714546 (EPOR)
SSDB
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Other DBs
NCBI-GeneID: 714546
NCBI-ProteinID: XP_001105833
Ensembl: ENSMMUG00000038989
LinkDB
Position
19
AA seq 508 aa
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLVARGPEELLCFTERLEDL
VCFWEEAASAGVSPDNYSFSYHLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRIIHINEVVLLDAPVGLVARLADEGGHIVLRWLPPPEAPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVLILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SGHAQDTYLVLDKWLLPRNPPSEDLPGPDGSVDTVAMDEGSEASSCLSALASKPSPEGAS
AASFEYTILDPSSQLLRPWALSPELPSTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS
NT seq 1527 nt   +upstreamnt  +downstreamnt
atggaccacctcggggcgtccttgtggccccaggtcggctccctttgtctcctgctcgct
ggggccgcctgggcgcccccgcccaacctcccggaccccaagttcgagagcaaagcggcc
ttgctggtggcccgcggacccgaagagcttctgtgcttcaccgagcggttggaggacttg
gtgtgtttctgggaggaagcggcgagtgctggggtgagcccagacaactacagcttctcc
taccacctcgaggatgagccatggaagctttgtcgcctgcaccaggctcccacggctcgt
ggtgcggtgcgcttctggtgttcgctgcctacagccgacacgtcgagcttcgtgccccta
gagttgcgcgtcacagcagcctccggcgctccgcgatatcaccgtatcatccacatcaat
gaagtagtgctcctggacgcccccgtggggctggtggcacggctggctgacgagggcggc
cacatagtgttgcgctggctcccgccgcctgaggcacccatgacgtcccacatccgctac
gaggtggacgtctcggccggcaacggcgcagggagcgtgcagagggtggagatcctggag
ggccgcaccgaatgtgtgctgagcaacctgaggggccggacgcgctacaccttcgccgtc
cgcgcgcgtatggctgagccgagcttcggcggcttctggagcgcctggtcggagcctgtg
tcgctgctgacgcctagcgacctggaccccctcatcctgacgctctccctcatcctcgtg
ctcatcctggtgctgctgaccgtgctcgccctgctgtcccaccgccgggctctgaagcag
aagatctggcctggcatcccgagcccagagagcgagtttgaaggcctcttcaccacccac
aagggtaacttccagctgtggctgtaccagaacgatggctgcctgtggtggagcccctgc
acccccttcacagaggacccacctgcctccctggaagtcctctcagagcgctgctggggg
acgatgcaggcagtggagccggggacagatgatgagggccccctgctggagccagtgggc
agtgggcatgcccaggatacctatctggtgctggacaaatggttgctgccccggaacccg
cccagtgaggacctcccagggcctgatggcagtgtggacacagtagccatggatgaaggc
tcagaagcatcctcctgcttgtctgctttggcctcgaagcctagcccagagggagcctct
gctgccagcttcgagtacaccatcctggaccccagctcccagctcttgcgtccatgggca
ctgtcccctgagctgccctctaccccaccccacctaaagtacctgtaccttgtcgtatct
gactctggcatctcaactgactatagctcaggggactcccagggagcccaagggggctta
tccgatggcccctactccaacccttatgagaacagccttatcccagccgctgagcctctg
ccccctagctatgtggcttgctcttag

KEGG   Macaca mulatta (rhesus monkey): 716690
Entry
716690            CDS       T01028                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X2
  KO
K05055  interleukin 6 receptor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01521  EGFR tyrosine kinase inhibitor resistance
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04659  Th17 cell differentiation
mcc04932  Non-alcoholic fatty liver disease
mcc05163  Human cytomegalovirus infection
mcc05171  Coronavirus disease - COVID-19
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    716690 (IL6R)
   04066 HIF-1 signaling pathway
    716690 (IL6R)
   04151 PI3K-Akt signaling pathway
    716690 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    716690 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    716690 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    716690 (IL6R)
   04659 Th17 cell differentiation
    716690 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    716690 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    716690 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    716690 (IL6R)
   05163 Human cytomegalovirus infection
    716690 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    716690 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    716690 (IL6R)
   04090 CD molecules [BR:mcc04090]
    716690 (IL6R)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   716690 (IL6R)
CD molecules [BR:mcc04090]
 Proteins
  716690 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind Ig_3 ig Ig_2 fn3
Other DBs
NCBI-GeneID: 716690
NCBI-ProteinID: XP_001114404
UniProt: A0A5F8AUE5
LinkDB
Position
1
AA seq 697 aa
MPKPHPRPMKSESLEPRPRHWWVLGLPADSSGQPGYQALLYHRGKSHIASSRALQVCLSQ
RNPVHETKNQNKCPFLINRTGRKGSDGAGGPLFSPLRCGAVAGSHPLGRPVRGAVAPSAP
AFVTAPWDGPETLQREFLKCFPVLPGPSAALSHVRVGSLTDTETGQRERSRARRGAEGLA
VYIERRAPANGGCPRRLSQPARPPPRPCRPVPTSLSASAGPWSGSRGGSMLAVGCALLAA
LLAAPGAALAPGGCPAQEVARGVLTSLPGDSVTLTCPGGEPEDNATVHWVLRKPAVGSHL
SRWAGVGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVV
CEWGPRSTPSPTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVS
MCVASSVGSKLSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRL
RFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAM
GTPWTESRSPPAENEVSTPTQAPTTNKDDDNILSRDSANATSLPVQDSSSVPLPTFLVAG
GSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRPTPVLVPLISPP
VSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgcccaagcctcaccccagaccgatgaaatcagaatctctggagccccgaccgagacat
tggtgggttttggggctcccggctgattccagtgggcaaccaggctaccaagcactgctt
tatcataggggtaagagtcacatcgcctcctcgagggctctccaggtgtgcctttcacag
cgtaatcctgttcacgaaaccaaaaatcaaaacaagtgcccttttctcatcaacagaacc
gggaggaagggctctgacggggctggcggtcccctgttctccccgctcaggtgcggcgct
gtggcaggaagccaccccctcggtcggccggtgcgcggggctgttgcgccatccgctcca
gctttcgtaaccgcaccctgggacggcccagagacgctccagcgcgagttcctcaaatgt
tttcctgtgttgccaggaccgtccgccgctctgagtcatgtgcgagtgggaagtctcact
gacactgagaccggccagagggagcggagccgagcgcggcgcggggctgagggactcgca
gtgtatatagagcgccgggctcctgcgaatgggggctgcccccggagactgagccagcct
gcccgcccaccgccccgcccctgccgcccggttcccaccagcctgtccgcttctgcggga
ccatggagcggtagccgaggaggaagcatgctggccgtcggctgcgcgctgctggctgcc
ctgctggccgcgccgggggcggcgctggccccggggggctgccctgcgcaggaggtggcg
agaggtgtgctgaccagtctgccaggagacagcgtgactctgacctgcccagggggagag
ccggaagacaatgccactgttcactgggttctcaggaagccagctgtaggctcccacctc
agcagatgggctggcgtgggaaggaggctgctgctgaggtcggtgcagctccatgactct
ggaaactattcatgctaccgggccggccgcccggctggaactgtgcacttgctggtggat
gttccccccgaggagccccagctctcctgcttccggaagagccccctcagcaacgttgtt
tgtgagtggggtcctcggagcaccccatctccgacgaccaaggctgtgctgttggtgagg
aagtttcagaacagtccggccgaagacttccaggagccgtgccagtattcccaggagtcc
cagaagttctcctgccagttggcagtcccggagggagacagctctttctacatagtgtcc
atgtgcgtcgccagtagtgtcgggagcaagctcagcaaaactcagacctttcagggttgt
ggaatcttgcagcctgatccgcctgccaacatcacagtcactgccgtggccagaaacccc
cgctggctcagtgtcacctggcaagacccccactcctggaactcatctttctacagacta
cggtttgagctcagatatcgagctgaacggtcaaagacattcacaacatggatggtcaag
gacctccagcatcactgtgtcatccacgacgcctggagcggcctgaggcacgtggtgcag
cttcgtgcccaggaggagttcgggcaaggcgagtggagcgagtggagcccggaggccatg
ggcacgccttggacagaatccaggagtcctccagctgagaacgaggtgtccacccccacg
caggcacctactactaataaagatgatgataatattctctccagagattctgcaaatgcg
acaagcctcccagtgcaagattcttcttcggtaccactgcccacattcctggttgctgga
gggagcctggcgttcggaacgctcctgtgcattgccattgttctgaggttcaagaagacg
tggaagctgcgggctctgaaggaaggcaagacaagcatgcacccgccgtattctttgggg
cagctggtcccagagaggccgcgacccaccccagtgcttgttcctctcatctccccacca
gtgtcccccagcagcctggggtctgacaacacctcgagccacaaccgaccagatgccagg
gacccacggagcccttacgacatcagcaatacagactacttcttccccagatag

KEGG   Macaca mulatta (rhesus monkey): 716769
Entry
716769            CDS       T01028                                 

Gene name
IL20RB
Definition
(RefSeq) interleukin-20 receptor subunit beta
  KO
K05137  interleukin 20 receptor beta
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    716769 (IL20RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    716769 (IL20RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    716769 (IL20RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    716769 (IL20RB)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   716769 (IL20RB)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3 DUF3805
Other DBs
NCBI-GeneID: 716769
NCBI-ProteinID: NP_001181587
Ensembl: ENSMMUG00000007390
LinkDB
Position
2
AA seq 311 aa
MQTFTMVLQEIWTSLFMWFFYALIPCLLTDEVAILPAPQNLSVLSTNMKHLLMWSPVTVP
GETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQ
TSAWSILKHPFNRNSTILTPPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHV
KMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEAIPLVLALFAF
VGFMLILVVVPLFVWKMGRLLQYSCCPVVVLPDTLKITNSPQKLISCRREEVDACATAVM
SPEELLRAWIS
NT seq 936 nt   +upstreamnt  +downstreamnt
atgcagactttcacaatggttctacaagaaatctggacaagtcttttcatgtggtttttc
tacgcattgattccatgtttgctcacagatgaagtggccattctgcctgcccctcagaac
ctctctgtgctctcaaccaacatgaagcatctcttgatgtggagcccagtgaccgtgcct
ggagaaacagtgtactattctgtcgaataccagggggagtacgagagcctgtacacgagc
cacatctggatccccagcagctggtgctcactcactgaaggtcctgagtgtgatgtcact
gatgacatcacggccactgtgccatacaaccttcgtgtcagggccacactgggctcacag
acctcagcctggagcatcctgaaacatccctttaatagaaactcaaccatccttacccca
cctgggatggagatcaccaaagatggcttccacctggttattgagctggaggacctgggg
ccccagtttgagttccttgtggcctactggaggagggagcctggtgccgaggaacatgtc
aaaatggtgaggagcgggggtattccagtgcacctagaaaccatggagccaggggctgca
tactgtgtgaaggcccagacattcgtgaaggccattgggaggtacagtgccttcagccag
acagaatgtgtggaggtgcaaggagaggccattcccctggtactggccctgtttgccttt
gttggcttcatgctgatccttgtggtcgtgccactgttcgtctggaaaatgggccggctg
ctccagtactcctgttgccctgtggtggtcctcccagacaccttgaaaataaccaattca
ccccagaagttaatcagctgcagaagggaggaggtggatgcttgtgccacagctgtgatg
tctcctgaggaactcctcagggcctggatctcatag

KEGG   Macaca mulatta (rhesus monkey): 717549
Entry
717549            CDS       T01028                                 

Gene name
IL27RA
Definition
(RefSeq) interleukin-27 receptor subunit alpha
  KO
K19598  interleukin 27 receptor alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04659  Th17 cell differentiation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    717549 (IL27RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    717549 (IL27RA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    717549 (IL27RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    717549 (IL27RA)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL6/12 receptor family
   717549 (IL27RA)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 717549
NCBI-ProteinID: XP_001111176
Ensembl: ENSMMUG00000013538
LinkDB
Position
19
AA seq 636 aa
MRGGRGAPFWPWPLPKLALLPLLWLLFQRTRPQGSAGPLQCYGVGPLGDLNCSWEPLGDL
GAPSELHFQSQKYRSNKTQTVAVAAGQSWVAIPREQLTMSDKLLVWGTKAGQPLWTPIFV
NLETQMKPNAPQLGPDVDVSEDEPLEAIVHWAPPTWPSHKVLICQFHYRRCQEAAWTLLE
LELKTIPLAPVEIQDLELATGYQVYGRCRMEKEEDLWGEWSPILSFQTPPAAPKDVWVSG
NLCGTPGGEEPLLLWKAPGPCVQVSYKVWFWVGGRELSPEGVTCCGSLIPSGAEWARVSA
INATSWEPLTNLSLVCLDSASAPHSVAVSSIAGSTELLVTWRPGPGEPREHVVDWTRDGD
PLEKLNWVRLPPGNFSALLPGNFTVGIPYQITVTAVSASGLAPAPSIWGFREELAPLVGP
TLWRLQDAPPGTPAIAWGEVPRHQLRGHLTHYTLCAQGGTSPSVCMNVSGNTQSVTLPDL
PWGPCELWVTASTIAGQGPPGPILRLHLPDNTLRWKVLPGILFLWGLFLMGCGLSLATSG
RCYHLWHKVLPRWVWEKVPDPANSSSGQPHMEQVPEAQPLADLPILEVEEMEPPPVMESS
QPPQVTAPLDSGYEKHFLPTPEELGLLGTPRPQVLA
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgcggggaggcaggggcgcccctttctggccgtggccgctgcccaagctggcgctgctg
cctctgctgtggctgcttttccagcggacgcgtccccagggcagcgccgggccactgcag
tgctacggagttggacccttgggcgacttgaactgctcgtgggagcctcttggggacctg
ggagccccctccgagttacactttcagagccaaaagtaccgttccaacaaaacccagact
gtggcagtggcagccgggcagagctgggtggccattcctcgggaacagctcaccatgtct
gacaagctccttgtctggggcactaaggcaggccagcctctctggacccccatcttcgtg
aacctggaaacccaaatgaagccaaatgccccccagctgggccctgacgtggacgtttcc
gaggatgagcccctggaggccattgtccattgggccccacctacgtggccgtctcataaa
gttctgatctgccagttccactaccgaagatgtcaggaggcggcctggaccctgctggaa
ctggagctgaagaccatacccctggcccctgttgagatccaagatttggagctagccact
ggctaccaagtgtatggccgctgccgaatggagaaggaagaggatttgtggggcgagtgg
agccccattttgtccttccagacaccgcctgctgctccaaaagatgtgtgggtatcaggg
aacctctgtgggacgcctggaggagaggaacccttgcttctgtggaaggccccagggccc
tgtgtgcaggtgagctacaaagtctggttctgggttggaggtcgtgagctgagtccggaa
ggagttacctgctgcggctcccttattcccagcggggcagagtgggccagagtgtccgct
atcaacgccacaagctgggagcctctcaccaacctctctttggtctgcttggattcagcc
tctgccccccatagcgtggcggtcagcagcatcgctgggagcacggagctactggtgacc
tggcgaccggggcctggggagccacgggagcatgtagtggactggactcgagatggggac
cccctggagaaactcaactgggtccggcttccccctgggaacttcagtgctctgttacca
gggaatttcacagtcggcatcccctatcaaatcactgtgaccgcagtttctgcttcgggt
ttggcccctgcaccctccatctgggggttcagagaggaactagcacccctagtggggcca
acgctttggcgactccaagatgcccctccagggacccccgccatagcgtggggagaggtc
ccaaggcaccagcttcgaggacacctcacccactacaccttgtgtgcccagggtggaacc
agcccctccgtctgcatgaatgtgagtggcaacacacagagtgtcaccctgcctgacctt
ccttggggtccctgtgagctgtgggtgacagcatctaccatcgctggacagggccctcct
ggtcccatcctccggcttcatctaccagataacaccctgaggtggaaagtcctgccgggc
atcctgttcttgtggggcttgttcctgatggggtgtggtctgagcctggccacctctgga
aggtgctaccacctatggcacaaggtgctgccccgctgggtctgggagaaggttcctgat
cctgccaacagcagttcaggccagccccacatggagcaagtgcctgaggcccagcccctt
gcggacttgcccatcctggaagtggaggagatggagcccccgccggttatggagtcctcc
cagcccccccaggtcacagccccacttgactctgggtatgagaagcacttcctgcccaca
cctgaggagctgggccttctgggcacccccaggccgcaggttctggcctga

KEGG   Macaca mulatta (rhesus monkey): 719264
Entry
719264            CDS       T01028                                 

Gene name
IL22RA1
Definition
(RefSeq) interleukin-22 receptor subunit alpha-1 isoform X1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04061  Viral protein interaction with cytokine and cytokine receptor
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    719264 (IL22RA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    719264 (IL22RA1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    719264 (IL22RA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mcc04050]
    719264 (IL22RA1)
Cytokine receptors [BR:mcc04050]
 Interleukin receptor families
  IL10/28 receptor family
   719264 (IL22RA1)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 719264
NCBI-ProteinID: XP_014986706
LinkDB
Position
1
AA seq 576 aa
MRTLLTILAVGSLAAHAPEDPSDLLQHVKFQSNNFENILTWDSGPEGTPDTVYSIEYKTY
GERDWVAKKGCQRITRKSCNLTVETGNHTELYYARVTAVSAGGRSATKMTDRFNSLQHTA
LKPPDVTCIPKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMVNH
LGGEQREYEFFGLTPDTEFLGTIMICVPTWSKKSAPYMCRVRTLPDRTWTYSFSGAFLFS
MGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPAFDLSGPSSLAQP
VQYSQIRVSGPREPAGPPQRHSLSEITYLGQPDISILQPANVPPPQILSPLSYAPNAAPE
VGPPSYAPQVTPEAQLPFYTPQAVSKVQPPSYAPQATPDSWPPSYGVCVEGSGKDSPTVT
LSSPKHLRPKGQLQKDPPAGSCMSGGLSLQEVTSLAMEESQEAKSLHQPLGVCTDRTSDL
NVLDSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLHPPSRPCSPSDQGPSPWGLLESLVC
PKDEAKSLAPETSDLEQPTELDSLFRGLALTVQWES
NT seq 1731 nt   +upstreamnt  +downstreamnt
atgaggacgctgctgaccatcctggctgtgggatccctggccgctcacgcccctgaggac
ccctcagatctgctccagcacgtgaaattccagtccaacaactttgaaaacatcctgacg
tgggacagcgggccggagggcaccccagacacggtctacagcatcgagtataagacgtac
ggagagagggactgggtggcaaagaagggctgtcagcggatcacccgaaagtcctgcaac
ctgacggtggagacgggcaaccacacggagctctactatgccagggtcaccgctgtcagc
gcgggaggccggtcagccaccaagatgactgacaggttcaactctttgcagcacactgcc
ctcaagccacctgatgtgacctgtatccccaaagtgagatcgattcagatgattgttcat
cctacccccacgcccatccgtgcaggggacggccaccggctaaccctggaagacatcttc
catgacctgttctaccacttagagctccaggtcaaccgcacctaccaaatggtaaatcac
cttggaggggagcagagagaatatgagttcttcggactgacccctgacacagagttcctt
ggcaccatcatgatttgtgttcccacctggtccaagaagagtgccccctacatgtgccga
gtgaggacactgccagaccggacgtggacctactccttctccggagccttcctgttctcc
atgggcttcctcgtcgcagtgctctgctacctgagctacagatatgtcaccaagccgcct
gcacctcccaactctctgaacgtccagcgagtcctgactttccagccgctgcgcttcatc
caggagcacgtcctgatccctgcctttgacctcagtggccccagcagtctggcccagcct
gtccagtactcccagatcagggtgtctggacccagggagcccgcaggacctccacagcgg
cacagcctgtccgagatcacctacttagggcagccggacatctccatcctccagcccgcc
aacgtgccacctccccagatactctccccactgtcctatgccccaaacgctgcccctgag
gtcgggcccccatcctatgcacctcaggtgacccccgaagctcaactcccattctacacc
ccacaggccgtctctaaggtccagcctccctcctatgcccctcaggcaactccagacagc
tggcctccctcctatggggtatgcgtggaaggttctggcaaagactcccccactgtgaca
ctttctagtcctaaacaccttaggcctaaaggtcagcttcagaaagacccgcccgctgga
agctgcatgtcaggtggcctttctctgcaggaggtgacctccttggctatggaggaatcc
caagaagcaaaatcattgcaccagcctctgggagtttgcacagacagaacatctgacctg
aatgtgctagacagtggggaggaagggacgccacagtacctaaagggccagctccccctc
ctctcctcagtccagatcgagggccaccccatgtccctgcctttgcatcctccttcccgc
ccatgctcgccctcggaccagggtccaagtccctggggcctgctggagtctcttgtgtgt
cccaaggatgaagccaagagcctagcccctgagacctcagacctggagcagcccacagag
ctggattctcttttcagaggcctggccctgaccgtacagtgggagtcctga

DBGET integrated database retrieval system