Macaca mulatta (rhesus monkey): 100423954 Help Entry 100423954         CDS       T01028                                  Name (RefSeq) C-C motif chemokine 3-like 1   KO K05408   C-C motif chemokine 3 Organism mcc  Macaca mulatta (rhesus monkey) Pathway mcc04060   Cytokine-cytokine receptor interaction mcc04061   Viral protein interaction with cytokine and cytokine receptor mcc04062   Chemokine signaling pathway mcc04620   Toll-like receptor signaling pathway mcc05142   Chagas disease mcc05163   Human cytomegalovirus infection mcc05323   Rheumatoid arthritis mcc05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mcc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100423954    04061 Viral protein interaction with cytokine and cytokine receptor     100423954  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100423954    04062 Chemokine signaling pathway     100423954  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100423954   09174 Infectious disease: parasitic    05142 Chagas disease     100423954   09163 Immune disease    05323 Rheumatoid arthritis     100423954   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100423954  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mcc04052]     100423954    00536 Glycosaminoglycan binding proteins [BR:mcc00536]     100423954 Cytokines and neuropeptides [BR:mcc04052]  Cytokines   Chemokines    100423954 Glycosaminoglycan binding proteins [BR:mcc00536]  Heparan sulfate / Heparin   Chemokines    100423954 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100423954 NCBI-ProteinID:  XP_002800705 Ensembl:  ENSMMUG00000042343 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MQVSTAALAVLLCTVALCKQVFSAPLGADTPTSCCFSYISRHIPQNFIADYFETSSQCSK PGVIFLTKRGRQVCADPSEDWVQKYVSDLELSA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcaggtctccactgctgcccttgccgtcctcctctgcaccgtggctctctgcaagcag gtcttctctgcaccacttggtgctgacacgccgacctcctgctgcttcagctacatctcc cggcacattccacagaatttcatagctgactactttgagaccagcagccagtgctccaag cccggtgtcattttcctaaccaagagaggccggcaggtctgtgctgaccccagtgaggac tgggtccagaaatacgtcagcgacctggagctgagtgcctga

DBGET integrated database retrieval system