KEGG   Macaca mulatta (rhesus monkey): 100424246
Entry
100424246         CDS       T01028                                 

Gene name
VAV1
Definition
(RefSeq) proto-oncogene vav isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100424246 (VAV1)
   04024 cAMP signaling pathway
    100424246 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100424246 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100424246 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100424246 (VAV1)
   04660 T cell receptor signaling pathway
    100424246 (VAV1)
   04662 B cell receptor signaling pathway
    100424246 (VAV1)
   04664 Fc epsilon RI signaling pathway
    100424246 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    100424246 (VAV1)
   04670 Leukocyte transendothelial migration
    100424246 (VAV1)
   04062 Chemokine signaling pathway
    100424246 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100424246 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100424246 (VAV1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    100424246 (VAV1)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100424246 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 C1_2 DUF3104 LZ3wCH PH_16 IL5
Other DBs
NCBI-GeneID: 100424246
NCBI-ProteinID: XP_014978134
Ensembl: ENSMMUG00000019314
UniProt: G7NMM1
LinkDB
Position
19
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNRGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRS
EPVSMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAIEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQIRDDSSGDRDNKKWSHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFPGTMRKDKLHRRAQDKKRNELGLPKMEVF
QEYYGLPPPPGAIGPFLRLNPGDIVELTKAEAEQNWWEGRNTSTNEIGWFPCNRVKPYIR
GPPQDLSVHLWYAGPMERAGAENILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISKPAVGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagctgtggcgccagtgcacccactggctcatccagtgccgagtgctgccgcccagc
caccgcgtgacctgggatggggctcaggtgtgtgaactggcccaggccctccgggatggt
gtccttctatgtcagctgcttaacaacctgctaccccatgccatcaacctgcgtgaggtc
aacctgcgcccccagatgtcccagttcctgtgccttaagaacattagaaccttcctgtcc
acctgctgtgagaagtttggcctcaagcggagtgagctcttcgaagcctttgacctcttc
gacgtgcaggattttggcaaggtcatctacaccctgtctgctctgtcctggaccccgatc
gcccagaacagggggatcatgcccttccccaccgaggaggagagtgtaggtgatgaagat
atctacagtggcctgtccgaccagatcgacgacacggtggaagaggatgaggacctgtat
gactgcgtggagaatgaggaggcggaaggcgacgagatctatgaggacctcatgcgctcg
gagcccgtgtccatgccgcccaagatgacagagtatgacaagcgctgctgctgcctgcgg
gagattcagcagacggaggagaagtacacggacacactgggctccatccagcagcatttc
atgaagcccctgcaacggttcctgaaacctcaagacattgagatcatctttatcaacatt
gaggacctgcttcgtgttcatactcacttcctaaaggagatgaaggaagccctgggcacc
cctggcgcagccaatctctaccaggtcttcatcaaatacaaggagaggttcctcgtctac
ggccgctactgcagccaggtggagtcagccagcaaacacctggatcgtgtggccgcagcc
cgggaggacgtgcagatgaagctggaggaatgttctcagcgagccaacaacgggaggttc
accttgcgggacctactgatggtgcctatgcagcgagttctcaaatatcaccttcttctc
caggagctggtgaaacacacgcaggaggctatagagaaggagaacctgcggctggccctg
gatgccatgagggacctggctcagtgcgtgaacgaggtcaagcgagacaacgagacactg
cggcagatcaccaatttccagctctccattgagaacctggaccagtctctggctcactat
ggccggcccaagatcgacggggagctcaagatcacctcggtggaacggcgctccaagatg
gacaggtatgccttcctgctcgacaaagctctgctcatctgtaaacgccggggagactcc
tatgacctcaaggactttgtgaacctgcacagcttccagattcgggatgactcttcagga
gaccgcgacaacaagaagtggagccacatgttcctgctgattgaggaccaaggtgcccag
ggctatgaactgttcttcaagacaagagagctgaagaagaagtggatggagcagtttgag
atggccatctccaacatctacccggagaatgccaccgccaacgggcatgacttccagatg
ttctcttttgaggagaccacgtcctgcaaggcttgtcagatgctgcttagaggcactttc
tatcagggctatcgctgccatcggtgccgggcacctgcacacaaggagtgtctggggagg
gtccctccgtgtggccgacatgggcaagatttcccgggaactatgaggaaggacaaactg
catcgcagggctcaggacaaaaagaggaatgagctgggtctgcccaagatggaggtgttc
caggaatactatgggcttcctccaccccctggagccattggaccctttctacgactcaac
cctggagacattgtggagctcacaaaggctgaggctgaacagaactggtgggagggcagg
aatacatctactaatgaaattggctggtttccttgtaacagggtgaagccctacatccgt
ggccctcctcaggacctgtctgttcatctctggtacgcaggccccatggaacgggcaggg
gcagaaaacatcctggccaaccgctcggacgggactttcttggtgcggcagagggtgaag
gatgcagcagaatttgccatcagcattaaatataacgtcgaggtcaagcacattaaaatc
atgacagcagagggactgtaccggatcacagagaagaaggctttccgggggcttacggag
ctagtggagttttaccagcagaactccctaaaggattgcttcaagtctctggacaccacc
ttgcagttccccttcaaggagcctgagaagaggaccatcagcaagccagcagtgggaagc
acaaagtattttggcacagccaaagcccgctatgacttctgcgcccgggaccgatcagag
ctgtcgctcaaggagggtgacatcatcaagatccttaacaagaagggacagcaaggctgg
tggcgaggggagatctatggccgggttggctggttccctgccaactacgtggaggaagat
tattctgaatactgctga

KEGG   Macaca mulatta (rhesus monkey): 694685
Entry
694685            CDS       T01028                                 

Gene name
VAV3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3 isoform X2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    694685 (VAV3)
   04024 cAMP signaling pathway
    694685 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    694685 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    694685 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    694685 (VAV3)
   04660 T cell receptor signaling pathway
    694685 (VAV3)
   04662 B cell receptor signaling pathway
    694685 (VAV3)
   04664 Fc epsilon RI signaling pathway
    694685 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    694685 (VAV3)
   04670 Leukocyte transendothelial migration
    694685 (VAV3)
   04062 Chemokine signaling pathway
    694685 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    694685 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    694685 (VAV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    694685 (VAV3)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   694685 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_9 SH3_1 SH2 C1_1 PH CDC24 Filamin PH_16 PH_10 LZ3wCH Prok-RING_1 Zn_ribbon_17 C1_2 zf-RING-like
Other DBs
NCBI-GeneID: 694685
NCBI-ProteinID: XP_001083337
Ensembl: ENSMMUG00000019714
LinkDB
Position
1
AA seq 847 aa
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEI
NLRPQMSQFLCLKNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESINDEDVYKGLPDLIDETLVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCPENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFMNIPE
LVKLHRNLMQEIHDSIVNKNDHNLYQVFINYKERLVIYGQYCSGVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTADATEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHDFKMHTFTRVTSCKVCQMLLRGTFYQ
GYLCFKCGARAHKECLGRVDNCGRVNSGEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVI
RNYSGTPPPALHEGPPLHLQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSTGQRVNRA
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccgtggaagcagtgtgcgcagtggctcatccattgcaaggtgctgcccgccaac
caccgagtgacctgggactcggcgcaggtattcgacctggcgcagaccctccgcgatgga
gtcctgctctgccagctgcttaacaacctccgggcgcactccatcaacctgaaggagatc
aacctgaggccgcagatgtcccagttcctctgtttgaagaacataaggacatttctcacg
gcctgttgtgagacatttggaatgaggaaaagtgaactcttcgaggcatttgacctgttt
gatgttcgtgactttggaaaggttatagaaacattatcacgactttctcgaacacctata
gctctggccacaggaatcaggcccttcccaacagaagaaagcattaacgatgaagacgtc
tacaaaggccttcctgatttaatagatgaaacccttgtggaagatgaggaagatctctat
gactgtgtttatggggaagatgaaggtggagaagtctatgaggacttaatgaaggcagag
gaagcacatcaacccaaatgtccagaaaatgatatacgaagttgttgtctagcagaaatt
aagcagacagaagaaaaatatacagaaactttggagtcaatagaaaaatatttcatggca
ccactaaaaagatttctgacagcagcagaatttgattcggtattcatgaacattcctgaa
cttgtaaaactgcatcggaacctaatgcaagagattcatgattccattgtaaataaaaat
gaccataacttgtaccaagtttttattaactacaaggaaagattagttatttacgggcag
tactgcagtggagtagagtcggccatctctagtttagactacatttctaagacaaaagaa
gatgtcaaactgaaattagaggaatgttccaaaagagcaaataatgggaaatttactctt
cgagacttgcttgtggttcctatgcaacgtgttttaaagtaccaccttctcctccaggaa
ctggtcaaacataccgctgatgcgactgagaaggcaaatctgaaactggctcttgatgcc
atgaaggacttggcacaatatgtgaatgaagtgaaaagagataatgagacccttcgtgaa
attaaacagtttcagctatctatagagaatttgaaccaaccagttttgctttttggacga
cctcagggagatggtgaaattcgaataaccactctagacaagcatacaaaacaagaaagg
catatcttcttatttgatttggcagtgatcgtatgtaagagaaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaagatagccaataatcctacaaccgataaa
gaaaataaaaagtggtcttatggcttctacctcatccatacccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaagaaatggctagaacagtttgaaatggct
ttgtctaacataaggccagactatgcagactccaatttccacgacttcaagatgcacacc
ttcactcgagtcacatcctgcaaagtctgccagatgctcctgaggggaacattttatcaa
ggctatttatgttttaagtgtggagcgagagcacacaaagaatgtttgggaagagtagac
aattgtggcagagttaattctggtgaacaagggacactcaaactaccagagaaacggacc
aatggactgcgaagaactcccaagcaggtggatccaggtttaccaaagatgcaggtcatt
aggaactattctggaacaccacccccagctcttcatgaaggaccccctttacacctccag
gccggggatacggttgaacttctgagaggagatgcacacagtctgttttggcagggcaga
aatttagcatctggagaggttggattttttccaagtgatgcagtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caagcagagactgaacttattaatagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctctcaaggaagggttcagaaccttagataca
actctgcagtttccatacaaggagccagaacattcaactggacagagggttaatagagca
ggcaacagcttgttaagtccaaaagtgctgggcattgccatcgctcggtacgacttctgt
gcaagagatatgcgagagttgtccttgttgaagggagatgtggtgaagatttacacaaag
atgagtgcaaatggctggtggagaggagaagtaaacggcagggtgggctggtttccatcc
acgtatgtggaagaggatgaataa

KEGG   Macaca mulatta (rhesus monkey): 713227
Entry
713227            CDS       T01028                                 

Gene name
VAV2
Definition
(RefSeq) guanine nucleotide exchange factor VAV2
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04510  Focal adhesion
mcc04650  Natural killer cell mediated cytotoxicity
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04670  Leukocyte transendothelial migration
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    713227 (VAV2)
   04024 cAMP signaling pathway
    713227 (VAV2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    713227 (VAV2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    713227 (VAV2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    713227 (VAV2)
   04660 T cell receptor signaling pathway
    713227 (VAV2)
   04662 B cell receptor signaling pathway
    713227 (VAV2)
   04664 Fc epsilon RI signaling pathway
    713227 (VAV2)
   04666 Fc gamma R-mediated phagocytosis
    713227 (VAV2)
   04670 Leukocyte transendothelial migration
    713227 (VAV2)
   04062 Chemokine signaling pathway
    713227 (VAV2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    713227 (VAV2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    713227 (VAV2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mcc04990]
    713227 (VAV2)
Domain-containing proteins not elsewhere classified [BR:mcc04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   713227 (VAV2)
SSDB
Motif
Pfam: RhoGEF CAMSAP_CH SH3_2 CH SH3_1 SH3_9 SH2 C1_1 PH CDC24 PLU-1 PH_10 C1_2 SH2_2 PH_16 Zn_ribbon_17 zf-RING-like
Other DBs
NCBI-GeneID: 713227
NCBI-ProteinID: NP_001252562
Ensembl: ENSMMUG00000017214
UniProt: I2CU78
LinkDB
Position
15
AA seq 878 aa
MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
QQPMIRYMQKMSMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
FINLEDLIKVHHSFLRAIDVSMMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
SPASCASYNFSFLGPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ
NT seq 2637 nt   +upstreamnt  +downstreamnt
atggagcagtggcggcagtgcggccgctggctcatcgactgcaaggtcctgccgcccaac
caccgggtggtgtggccctcggccgtggtcttcgacctggcgcaggcgctgcgcgacggg
gtcctcctgtgccagctgctgcacaacctctcccccggctccatcgacctcaaggacatc
aacttccggccgcagatgtcccagttcctgtgtttgaagaacatacggaccttcctgaaa
gtctgccacgataaatttggattaaggaacagtgagctgtttgacccctttgacctcttc
gatgtgcgagactttggaaaggtcatctccgcggtgtcgaggctctcactgcacagcatt
gcgcagaacaaaggaatcaggccttttccctcagaggagaccacagagaatgacgatgac
gtctaccgcagcctggaggagctggcggatgagcatgacctgggggaggacatctacgac
tgcgtcccgtgtgaggatggaggggacgacatctacgaggacatcatcaaggtggaggtg
cagcagcccatgattagatacatgcagaaaatgagcatgactgaggatgataaaaggaac
tgctgcctgctggagatccaggagaccgaggccaagtactaccgcaccctggaggacata
gagaagaactacatgagccctctgcggctggtgctgagcccggcggacatggcggctgtc
ttcattaacctggaggacctgatcaaggtgcatcacagcttcctgagggccatcgacgtg
tccatgatggtggggggcagcacgctggccaaggtctttctcgatttcaaggaaaggctc
ctgatctacggggagtactgcagccacatggagcacgcccagaacactctgaaccagctc
ctggccagccgggaggacttcaggcagaaagtcgaggagtgcacgctgaaggtccaggat
ggaaaatttaaactacaagacctgctggtggtccccatgcagagggtgctcaaataccac
ctgctcttgaaggagcttctgagccattctgcggaacggcctgagaggcagcagctcaaa
gaagcactggaagctatgcaggacttagcgatgtacatcaatgaagttaaacgggacaag
gagaccttgaggaaaatcagcgaatttcagagttctatagaaaacttgcaagtgaaactg
gaggaatttggaagaccaaagattgacggggaactgaaagtccggtccatagtcaaccac
accaagcaggacaggtacttgttcctgtttgacaaggtggtcatcgtctgcaagcggaag
ggttacagctacgagctcaaggagatcatcgagctgcttttccacaagatgaccgatgac
cccatgaacaacaaggacgtcaagaagtctcacgggaaaatgtggtcctacggcttctac
ctaattcaccttcaaggaaagcaaggtttccagtttttctgcaaaacagaagatatgaag
aggaagtggatggagcagtttgagatggccatgtcaaacatcaagccggacaaagccaat
gccaaccaccacagtttccagatgtacacgtttgacaagaccaccaactgcaaagcctgc
aaaatgttcctcaggggcaccttctaccagggatacatgtgcaccaagtgtggcgtcggg
gcacacaaggagtgcctggaagtgatacctccctgcaagtttacttctcctgcagatctg
gacgcctccggagcgggaccaggtcccaagatggtggccatgcagaattaccatggcaac
ccagcccctcccgggaagcctgtgctgaccttccagacgggcgacgtgcttgagctgctg
aggggtgaccctgagtctccgtggtgggagggtcgtctggtgcaaaccaggaagtcaggg
tatttccccagctcatctgtgaagccctgccctgtggatggaaggccgcccatcagccgg
ccgccgtcccgggagatcgactacactgcatacccctggtttgcaggtaacatggagagg
cagcagacggacaacctgctcaagtcccacgccagcgggacctacctaatcagggagcgg
cctgctgaggctgagcgctttgcaataagcatcaagttcaacgatgaagtgaagcacatc
aaggtggtggagaaggacaactggatccacatcacagaagccaagaaattcgacagcctc
ctggagttggtggagtactaccagtgccactcactcaaggagagcttcaagcagctggac
accacactcaagtacccctacaagtcccgggaacgctcggcctccagggcctccagccgg
tccccagcttcctgtgcttcctacaacttttcttttctcggtcctcagggcctcagcttt
gcttctcagggcccctccgctcccttctggtcagtgttcacgccccgcgtcatcggcacg
gctgtggccaggtacaactttgctgcccgagacatgagagagctttcgctgcgggagggt
gacgtggtgaggatctacagccgcatcggcggggaccagggctggtggaagggcgagacc
aacggacggattggctggtttccttcaacgtacgtagaagaggagggcatccagtga

DBGET integrated database retrieval system