KEGG   Macaca mulatta (rhesus monkey): 100424593
Entry
100424593         CDS       T01028                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100424593 (PLA2G4E)
   00565 Ether lipid metabolism
    100424593 (PLA2G4E)
   00590 Arachidonic acid metabolism
    100424593 (PLA2G4E)
   00591 Linoleic acid metabolism
    100424593 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    100424593 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100424593 (PLA2G4E)
   04014 Ras signaling pathway
    100424593 (PLA2G4E)
   04370 VEGF signaling pathway
    100424593 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    100424593 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100424593 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100424593 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    100424593 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    100424593 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100424593 (PLA2G4E)
   04913 Ovarian steroidogenesis
    100424593 (PLA2G4E)
   04921 Oxytocin signaling pathway
    100424593 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100424593 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    100424593 (PLA2G4E)
   04726 Serotonergic synapse
    100424593 (PLA2G4E)
   04730 Long-term depression
    100424593 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100424593 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100424593 (PLA2G4E)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100424593 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100424593
NCBI-ProteinID: XP_014997506
LinkDB
Position
7
AA seq 869 aa
MSLQASEGFPGLETNVFVPQSPQRDEEGSRSGRSFSEFEDTQDLNTPGLPPFCPMAPWGS
QEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSQVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGLEEL
EVEFLLEESPSSPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKTKDLLVMVSESFQNTQ
RVRPCLEPCCPTSACFQTSACFHYPKYFQSQVHVEVPKSHWSCGLCCCGSHKNGPVSQPL
DCLSDGQVMTLPVGESYELHMKSTPCPEMLDVRLGFSLCPAELEFLQKRKVVVAKALKQV
LQLEADLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMA
TLYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLLKFREELRQRSQEGYRVTFTDFW
GLLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVG
LQKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFF
HRWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFL
SGLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKV
DLIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIV
TFFPLINDTFQKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEY
NILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgagtctccaggcctcagaaggctttcctgggctggaaactaatgtgtttgtcccacag
agcccgcaaagggatgaagaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctgaacactcctggtctcccacctttctgtcccatggctccttggggctct
caggaggggctgtctccatgccacctgttgacagtgcgggtcatccggatgaaaaatgtc
cggcaggctgatatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaacccagagtggaatgaa
agcttcaatttccagatccagagccaagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacaccagatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcctggaagagctg
gaggtggagttcctgctggaggagagtccctcttcacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaacgaaggaccttctggtgatggtgagcgagtcctttcagaacacccag
cgtgtccggccctgcttggaaccctgctgtccaacctctgcctgcttccaaacctctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtacccaagagtcac
tggagctgtgggctttgctgctgcggctctcacaagaacggccccgtcagccagcccctc
gactgcctttccgatggtcaggtgatgaccctgcctgtgggcgagagttatgaattacac
atgaagtctacaccctgccctgagatgctggacgtgcggctgggcttcagcctgtgccca
gcagagctggagtttctgcagaagcggaaggtggtggtggccaaggccctgaagcaggtg
ctgcagttggaggcggacctgcaggaggatgaggtgccgctgatagccatcatggccact
gggggtggaacaagatccatgacctccatgtatggccacctgctggggctacagaagctg
aacctcctggactgtgccagctacatcactggcctgtcaggggccacctggaccatggct
accttgtaccgggaccctgactggtcctccaaaaacctggagcctgctatctttgaggcc
cggagacacgtggtaaaggacaagctaccctccctgttcccagaccagctcctcaaattc
cgggaggaactccggcagcgcagccaggaaggctacagagtcacctttacagacttctgg
ggcctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcag
cgtgctgctttgagctgtggccagaaccccctgcccatctacctcaccatcaatgtcaag
gatgatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggt
ctgcagaagtatggggccttcatcccctctgagctcttcggctccgagttcttcatgggg
cggctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagc
atcttctccctgaacctgctggatgcctggaacctgtcacacacctcagaagagtttttc
cacaggtggacaagggagaaagtgcaggacatcgaagatgagccaatcctgcccgaaatt
cccaaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcatggctgtcc
aattctttccgagaaatccttacccaccggtccttcgtgtctgagtttcacaacttcctg
tccgggctgcagctgcacaccaactacctccagaatggccagttctctagatggaaagac
acagtgctggatggtttcccaaaccagctgaccgagtccgcaaaccacctgtgcctgctg
gacactgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagtc
gacctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaact
tgtgagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaat
gaaaatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtg
actttcttcccactcatcaatgatactttccaaaaatacaaggcaccaggtgtggagcga
agccctgaggagctagagcagggccaggtggacatttatggtcccaaaactccgtatgcc
accaaggagctgacgtacacagaagccaccttcgacaagctggtgaaactctcagagtac
aacatcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaag
aagcgcctgaagggccagtgtccctcctag

KEGG   Macaca mulatta (rhesus monkey): 100533113
Entry
100533113         CDS       T01028                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100533113 (PLA2G4B)
   00565 Ether lipid metabolism
    100533113 (PLA2G4B)
   00590 Arachidonic acid metabolism
    100533113 (PLA2G4B)
   00591 Linoleic acid metabolism
    100533113 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    100533113 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100533113 (PLA2G4B)
   04014 Ras signaling pathway
    100533113 (PLA2G4B)
   04370 VEGF signaling pathway
    100533113 (PLA2G4B)
   04072 Phospholipase D signaling pathway
    100533113 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100533113 (PLA2G4B)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100533113 (PLA2G4B)
   04664 Fc epsilon RI signaling pathway
    100533113 (PLA2G4B)
   04666 Fc gamma R-mediated phagocytosis
    100533113 (PLA2G4B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100533113 (PLA2G4B)
   04913 Ovarian steroidogenesis
    100533113 (PLA2G4B)
   04921 Oxytocin signaling pathway
    100533113 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100533113 (PLA2G4B)
  09156 Nervous system
   04724 Glutamatergic synapse
    100533113 (PLA2G4B)
   04726 Serotonergic synapse
    100533113 (PLA2G4B)
   04730 Long-term depression
    100533113 (PLA2G4B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100533113 (PLA2G4B)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100533113 (PLA2G4B)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     100533113 (PLA2G4B)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 100533113
NCBI-ProteinID: NP_001191155
Ensembl: ENSMMUG00000003842
LinkDB
Position
7
AA seq 781 aa
MALAEVSRTCLLTVRVLKAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVVELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRHKSFSLSPQGEG
CLEVEFRLQSLADRGEQLVGNGVLVARELSCLHVQLEETGDQKPSERRVQLVVPGSCEGP
QEAPVGTGTFRFHCPACWEQELSIHLQDAPKEQLKVPLSALPSDQVVRLVFPTSQDPLMR
VELKKEAGPRELAVRLGFRPCAEEQAFLSRRKQVVATALRQALQLDRDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKSKLGVLAPSQLQRYRQELAERARLGYPSCFTSLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGRSLSTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLTKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTASRIAEFFTDLLTRRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVNDSFREYSAPGVQRTPEAA
AAGEVNLSSVDSPYHYTKVTYSQEDVDKLLRLTHYNVCNNREQLLEALRQAVQRRRQRRP
Q
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctctggcagaggtgtccaggacctgcctgctcacagttcgtgtcctgaaggcccat
cgcctaccctctaaggacctagtgaccccctctgactgctacgtgactctctggctgccc
acagcctgcagccacaggctccagacacgcacagtcaagaacagcagtagccctgtctgg
aaccagagctttcactttaggatccacaggcagctcaagaatgtcgtggaactgaaagtc
tttgaccaggacctggtgaccggagatgaccctgtgttgtcagtgctgtttgatgcgggg
actctgcgggctggggagttccggcacaagagcttctcactgagccctcagggtgagggg
tgcctggaagttgaatttcgcctgcagagtctggctgaccgtggcgagcagctcgttggc
aatggcgttctggtggcccgggagctctcctgcttgcacgttcaactggaggagacagga
gaccagaagccctcagagcgcagagttcagcttgtggttcctgggtcctgtgagggtccg
caggaggcccctgtgggcactggcaccttccgcttccactgcccagcctgctgggagcag
gagctgagtattcacctgcaggatgcccccaaggagcaactaaaggtgccactgagtgcc
ctgccctctgaccaagtggtgaggcttgtcttccccacatcccaggaccccctgatgaga
gtggagctgaaaaaagaagcaggaccgagggagctggccgtgcgactgggcttcaggccc
tgtgcagaggaacaggccttcctgagcaggaggaagcaggtggtggccacggccttgcgg
caggccctgcagctggacagagacctgcaggaggacgagatcccagtggtagctattatg
gccactggtggtgggatccgggcaatgacttccctgtacgggcagctggccggcctgaag
gagctgggcctcttggattgcgtctcctacattaccggggcctcgggctccacctgggcc
ttggccaacctctatgaggacccagagtggtctcagaaggacctggcagggcccactgag
ttgctaaagacccaggtgaccaagagcaagctcggtgtgttggcccccagccagctgcag
cggtaccggcaggagctggccgagcgtgcccgcctgggctacccaagctgcttcaccagc
ctgtgggccctcatcaacgaggcgctgctacatgacgagccccatgaccacaagctctca
gatcagcgggaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaggggcggagcctgtccacttttgaatttggggagtggtgcgagttctctccctac
gaggtcggcttccccaagtatggggccttcatcccctctgagctctttggctctgagttc
ttcatggggcagctgacgaagaggctccctgagtcccgcatctgcttcttagaaggtatc
tggagcaacctgtatgcagccaacctccaggacagcttatactgggcctcagagcccagc
cagttctgggaccgctgggtcaggaaccaggccaacctggacaaggagcaggtccccctt
ctgaagatagaagaaccaccctcaacagccagcaggatagctgagtttttcaccgatctt
ctgacacggcgcccactggcccaggccacacacaatttcctgcgtggcctccatttccac
aaagactactttcagcatcctcacttctccacctggaaagctaccactctggatgggctc
cccaaccagctgacaccctcggagccccacctgtgcctgctggatgttggctacctcatc
aacaccagctgcctgcccctcctgcagcccactcgggacgtggacctcatcctgtcattg
gactacaacctccacggagccttccagcagctgcagctcctgggccgcttctgccaggag
caggggatcccgttcccgcccatctcgcccagcccggaagagcagctccagcctcgggag
tgccacaccttctccgaccccacctgccccggagctcctgcggtgctgcacttccctctt
gtcaacgactccttccgggagtactcggcccctggggtccagcggacacctgaggcggcg
gcggctggggaggtgaacctgtcctcagtggactctccctaccactacacgaaggtgacc
tatagccaggaggatgtggacaagctgctgcgcctgacacattacaatgtctgcaacaac
cgggagcagctgctggaggccctgcgccaggcagtgcagcggaggcggcagcgcaggccc
cagtga

KEGG   Macaca mulatta (rhesus monkey): 707592
Entry
707592            CDS       T01028                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    707592 (PLA2G4D)
   00565 Ether lipid metabolism
    707592 (PLA2G4D)
   00590 Arachidonic acid metabolism
    707592 (PLA2G4D)
   00591 Linoleic acid metabolism
    707592 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    707592 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707592 (PLA2G4D)
   04014 Ras signaling pathway
    707592 (PLA2G4D)
   04370 VEGF signaling pathway
    707592 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    707592 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    707592 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    707592 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    707592 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    707592 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    707592 (PLA2G4D)
   04913 Ovarian steroidogenesis
    707592 (PLA2G4D)
   04921 Oxytocin signaling pathway
    707592 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    707592 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    707592 (PLA2G4D)
   04726 Serotonergic synapse
    707592 (PLA2G4D)
   04730 Long-term depression
    707592 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    707592 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    707592 (PLA2G4D)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     707592 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 707592
NCBI-ProteinID: XP_028706424
Ensembl: ENSMMUG00000003848
LinkDB
Position
7
AA seq 930 aa
MSRPLCRSLEPAQVRALVPAGDRAGPLISVFLLKRDFGMKMPKDVTDCSLRWPSAPGVSS
FIRFTVQIAKIQGEGVPQIPPWVGCYSLTAAAQNPDPKDRGGQRLCGPQRVSRNAWQRSV
SAPPSARRVEASACWQLTVRVLEARNLRRADLLSEADPYVILQLSTVPGMKFKTKTLTDT
SHPVWNEAFHFLIQSQVKNVLELSIYDEDSITEDDICFKVLYDISEVLPGKLLRKTFSQS
PQGEEELDVEFLMEETSDRPENLITNKVLVARELSCLDVHLDSAGSTAVVADQDKLELEL
ELKGSYEDTQTSSLGTASAFRFHYMAALETELSGCLRSSTSNVWNGDNSAQHLTVPLRPL
IGKEVTMDVPAQDVPGVRLQLKAEGCSKELAVHLGFNLCAEEQAFLSRRKQVVAKALKQA
LQLDGDLQEDEVPIVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGVSGSTWTMA
HLYGDPEWSQKDLEGPIRHAREHLAKSKLEVFSPERLGSYRRELELRAEQGHPTSFVDLW
ALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEWVEFSPYEV
GFLKYGAFVPPELFGSKFFMGRLMRRIPEPRICFLEAIWSNVFSLNLLDAWYDLTSSGES
WKQHIKDKTRSLEKEPLTSLETCSWLEASWLQPGTALAQAFKGFLTGRPLHQRSPNFLQG
LQLHQDYCSHKGFSTWADCQLDSTPSQLTPQEPQLCLVDAGYFINTSCPSMFRPGRRLDL
ILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPQDHQQPRECHLFSDPACPEAPILL
HFPLVNASFKDHSAPGVQRSPAELQAGQVNLTGATSPYALSNMTYKEEDFERLLRLSDYN
VQTSQGAILQALRTALKHRALEARPPGAQT
NT seq 2793 nt   +upstreamnt  +downstreamnt
atgtccagacccctctgccgctccctggagcctgctcaggtcagggcactggtgccagca
ggggacagggccggtccgctcatttccgtcttcctgctgaagagggactttggcatgaag
atgccgaaggatgtcaccgactgctccctacgatggcctagtgctcctggagtttcctca
ttcatacgctttacagtgcagattgccaagatccagggggagggggttccacaaatccca
ccctgggtgggctgctattccctgactgctgcagcccagaaccctgaccccaaagacaga
ggtggacaaaggctgtgtggtccccagagggtgtctcggaatgcctggcagcggtcggtg
tcggcaccgccaagtgccaggagagtggaggcctctgcctgctggcagctcaccgtgagg
gtcctggaggcgcggaacctgcgcagggctgacctgttgagtgaggccgacccttacgtg
atcctacagctgtcgaccgtgcctggaatgaagtttaagaccaagacgctcaccgacacc
agtcatcctgtgtggaatgaggccttccatttccttatccaaagtcaggtcaagaatgtt
ctggaacttagcatctatgatgaggactcaatcacggaggatgacatctgcttcaaggtt
ctctatgatatctcagaagtcctccctggcaagctgctccggaaaaccttctcccagagt
ccccagggagaggaggagctggatgtggagttcctgatggaagaaacgtcggatcgccca
gaaaacctcatcaccaacaaagtccttgtggcccgagagctgtcatgcctggatgtgcat
ctggacagcgcaggtagcaccgctgtggttgcagatcaggacaagttggagctggagctg
gagttgaaggggtcctatgaggacacacagacatcctccctgggcacagcctctgccttc
cgcttccactacatggcagccctagagacagagctgagtgggtgcctgaggagctccaca
agcaatgtctggaatggggacaactcagctcagcacctcactgtgcccctgaggcctttg
atcgggaaggaggtgaccatggatgttcctgctcaagatgtcccaggagtgaggctgcag
ctcaaggcagagggctgctccaaggagctggccgtgcacctgggcttcaatctgtgtgca
gaggagcaggccttcctgagcaggaggaagcaggtggtggccaaggccctgaagcaggcc
ctgcagctggacggagacctgcaggaggacgaggtacccattgtgggcatcatggccaca
ggaggaggtgcccgggccatgacctcactctacggccacttgttggccctgcagaagctg
ggcctgctggactgtgtgacctacttcagtggcgtctcaggctctacgtggacaatggcc
cacctgtacggggaccctgagtggtcgcagaaggacctggagggacctatcagacacgcc
cgggagcacctggccaagagcaagctggaggtcttttccccagagcgcctggggagttac
cgccgggagctggagctgcgggctgagcagggccaccccacatcttttgtggatctgtgg
gcgctagtgctggagtccatgctgcacggccaggtgatggatcagaagctgtcaggacag
agagccgccctggaacggggtcagaaccctctgcccctctacctgagcctcaatgtcaaa
gagaacaatctggagacgctggacttcaaggagtgggttgagttctccccctatgaggtc
gggttcctgaagtacggagccttcgtccctcctgagctcttcggctccaagttcttcatg
ggacggctgatgaggaggatcccggagccccggatctgctttctggaagccatctggagc
aacgttttctccctgaacctgctggacgcctggtatgacctcaccagctctggggagtcc
tggaaacagcacatcaaggacaagaccaggagcttagagaaggagcccctgacctccttg
gagacctgctcgtggctggaggcctcgtggctgcagccgggcacggcgctggcccaggca
tttaaaggcttcctgaccggcaggcccctccaccagcgcagccccaacttcctccagggc
ctccagctacaccaggactactgcagccacaagggcttctccacctgggcagactgccag
cttgactccacacccagccagctgactccccaggagccccagctctgcctggtggacgct
ggctacttcatcaacaccagctgtccctccatgttccggccgggccgcaggctggacctc
atcctctccttcgactactctctatctgcgccctttgaggcactgcagcagacagagctg
tactgccgggcccgggggctgcccttcccccgggtggaacccagccctcaggaccaccag
cagccaagggagtgccacctcttctcagaccccgcctgccccgaggccccgatcctgctg
catttcccgctggtcaatgcctccttcaaggaccattcagcccccggtgtccagcgcagc
cccgcagagctccaggctggccaagtgaatctcaccggggctacctccccctatgccctg
tccaacatgacctacaaggaggaagactttgagcgcctgctacggctcagtgactacaac
gtgcagaccagccagggtgccatcctgcaggccctgaggaccgcactgaagcaccgggcc
ctagaggcgagacctccaggggcacagacctga

KEGG   Macaca mulatta (rhesus monkey): 707690
Entry
707690            CDS       T01028                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    707690 (PLA2G4F)
   00565 Ether lipid metabolism
    707690 (PLA2G4F)
   00590 Arachidonic acid metabolism
    707690 (PLA2G4F)
   00591 Linoleic acid metabolism
    707690 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    707690 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    707690 (PLA2G4F)
   04014 Ras signaling pathway
    707690 (PLA2G4F)
   04370 VEGF signaling pathway
    707690 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    707690 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    707690 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    707690 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    707690 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    707690 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    707690 (PLA2G4F)
   04913 Ovarian steroidogenesis
    707690 (PLA2G4F)
   04921 Oxytocin signaling pathway
    707690 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    707690 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    707690 (PLA2G4F)
   04726 Serotonergic synapse
    707690 (PLA2G4F)
   04730 Long-term depression
    707690 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    707690 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    707690 (PLA2G4F)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     707690 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 707690
NCBI-ProteinID: XP_014997507
Ensembl: ENSMMUG00000015449
LinkDB
Position
7
AA seq 849 aa
MLWALWPRWLAGKMLPFLGAVLLQKRENRGPLRRHWRRETHPYYDLQVKVLRATNIRNTD
LLSKADCYVQLWLPTASPSPAQTRTVANCSDPEWNETFHYQIHDAVKNVLELTLYDKDIL
VSDQYSQLLFDLRSLECGQPHRHSFPLNRQDSQELQVEFVLEKSQVPASEIITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLTVPGAYEKPQLLPLQPPTEPGLQPTFTFHVNPV
LSSRLHVELMEQLSAVQSDPSAELEAQTSKLGEGGILLSSLPLGQEKQCSVALGEGQEVA
LSVKVEMSSGDLDLRLGFDLCDGEQEFLDRRKQVVAKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYAQELGVRKRSGHSVSPVDLWGLFVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSINVCSDMSGEDFAEWCEFTPYEVGLPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGVWGSAFATSLEEISLKTVGSGLSFLEWYRGSVNITDDCQKPQ
PHNPSTLPTRILTPQGPFSQAVLGIFTSRFTSAQIFNFTRGLCLHKDYVADREFVAWKDR
HPDASPNHLTPMRDCLYLVDGGFAINSPFPLALRPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPVVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFDRLVALSRYNILNNVETLKCALQLALDR
HQARERAGD
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcactctggccaaggtggctggcaggcaagatgctgcccttcctgggggca
gtgctgcttcagaagagagagaacaggggccctctgcggaggcactggcggcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggaatacagac
ctgctgtccaaagctgactgctacgtgcaactgtggctgcccacggcgtcccccagccct
gcccagactaggacagtggccaactgcagtgaccccgagtggaatgagactttccactac
cagatccatgatgctgtgaagaatgttctggagctcactctgtatgacaaggacatcctg
gtcagcgaccagtattcccagctcctgtttgacctgaggagcctcgagtgcggccaacct
cacagacacagcttcccactcaaccgccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaaatcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacactccggggagatgggaccgccccacgggaagagtac
ggctctcggcagctccagctgacagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcccacagagccaggcctccaacccacctttaccttccatgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagcagctctcggctgtgcagagcgacccc
agcgcggagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggagaaacagtgttctgtggccctgggggagggccaggaggtggct
ctgagtgtgaaggtggaaatgagctccggagacctagacctacgccttggctttgacctc
tgtgacggggagcaggagtttctggacaggaggaagcaggtcgtggccaaggccctgcag
caggtgctgggattgagtgaggctccggacagtggccaggttcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcctctctgtacggcagcctggcagggttgcag
gagctcggcctgctagacactgtgacctacctgagtggggtctctgggtccacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacgctcaggaactgggggtccggaagcgcagtggccacagcgtgtccccggtcgac
ctctggggcctctttgtggagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagtatcaac
gtctgctccgacatgagtggggaagattttgcagagtggtgcgagttcacgccctacgag
gttggcttgcccaagtacggggcttatgttcccaccgagctctttggctcagagcttttc
atgggacgattgctgcagctccagcccgagccccggatctgctacctgcaaggtgtgtgg
ggcagtgcctttgccaccagcctggaagagatctccctaaagactgtgggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagatgactgccagaagcctcag
ccacacaacccatcgacgctgccaacaaggatccttaccccacaggggcccttctcccag
gctgtgctgggcatattcacctcccgcttcacttctgcccagatttttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctgacagagagtttgtggcctggaaagacaga
cacccagacgcctcccccaaccatctcacccccatgcgggactgcctgtacctggtggac
ggaggcttcgccatcaactctccgttcccactggctctgcggcctcagagagccgtggac
ctcattctgtccttcgactattccttggaagctccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaagacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccgtcgtg
ctgcacttcccccttgtcaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttgtcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggactttgatcggctggtggccctgagtcga
tacaatattctgaacaatgtggagaccttgaagtgtgccctccagctggctctggaccgg
caccaggctcgggagagggctggggactga

KEGG   Macaca mulatta (rhesus monkey): 716635
Entry
716635            CDS       T01028                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    716635 (PLA2G4A)
   00565 Ether lipid metabolism
    716635 (PLA2G4A)
   00590 Arachidonic acid metabolism
    716635 (PLA2G4A)
   00591 Linoleic acid metabolism
    716635 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    716635 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    716635 (PLA2G4A)
   04014 Ras signaling pathway
    716635 (PLA2G4A)
   04370 VEGF signaling pathway
    716635 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    716635 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    716635 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    716635 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    716635 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    716635 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    716635 (PLA2G4A)
   04913 Ovarian steroidogenesis
    716635 (PLA2G4A)
   04921 Oxytocin signaling pathway
    716635 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    716635 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    716635 (PLA2G4A)
   04726 Serotonergic synapse
    716635 (PLA2G4A)
   04730 Long-term depression
    716635 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    716635 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    716635 (PLA2G4A)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     716635 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 716635
NCBI-ProteinID: XP_014977272
Ensembl: ENSMMUG00000021423
LinkDB
Position
1
AA seq 777 aa
MCNYGSPFNCLSSLTNRRFCLLQTWLCLLRSLNDNIPNSSLMLSVRIAFYRALKLAKVTK
GAFGDMLDTPDPYVELFISTTPDSRKRTRHFNNDINPVWNETFEFILDPNQENVLEITLM
DANYVMDETLGTATFPVSSMKVGEKKEVPFIFNQVTEMILEMSLEVCSCPDLRFSMALCD
QEKTFRQQRKENIRESMKKLLGPKNSEGLNSARDVPVVAILGSGGGFRAMVGFSGVMKAL
YESGILDCATYIAGLSGSTWYMSTLYSHPDFPEKGPEEINEELMKNVSHNPLLLLTPQKV
KRYVESLWKKKSSGQPVTFTDIFGMLIGETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCL
HVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLFGSKFFMGTVVKKYEENPLHFLMGV
WGSAFSILFNRVLGVSGSQSRGCTMEEELENITTKHIVSNDSSDSDDESHEPKGTENEDA
GRDYQSDNQASWIHRMIMAFVSDSALFNTREGRAGKVHNFMLGLNLNTSYPLSPLSDFAT
QDSFDDDELDAAVADPDEFERIYEPLDVKSKKIHVVDSGLTFNLPYPLILRPQRGVDLII
SFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKIDPYVFDREGLKECYVFKPKNPDMEQ
DCPTIIHFVLANINFRKYKAPGVPRETEEEKEIADFDIFDDPESPFSTFNFQYPNQAFKR
LHDLMHFNTLNNIDVIKEAMVESIEYRRQNPSRCSVSLSNVEARKFFNKEFLSKPKA
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgtgtaattatggttcacccttcaattgcttgagttccttgacaaatcggagattctgc
cttcttcaaacgtggttgtgtttgttgagatctttgaatgataacattccaaacagttct
ctgatgctatctgtcagaatagcattttaccgggcccttaaattagccaaagtcacaaag
ggggcctttggtgacatgcttgatactccagatccctatgtggaactttttatctctaca
acccctgacagcaggaagagaacaagacacttcaataatgatataaaccctgtgtggaat
gagacctttgaatttattctggatcctaatcaggaaaatgttttggagattacgttaatg
gatgccaattatgtcatggatgaaactctagggaccgcaacatttcctgtatcttcaatg
aaggtgggagagaagaaagaagttccttttattttcaaccaagtcactgaaatgattcta
gaaatgtctcttgaagtttgctcatgcccagacctacgatttagtatggctctgtgtgat
caggagaagactttcagacaacagagaaaagaaaacataagggagagcatgaaaaaactc
ttgggtccaaagaatagtgaaggattgaattctgcacgtgatgtgcctgtggtagccata
ttgggttcaggtgggggtttccgagccatggtgggattctctggtgtgatgaaggcatta
tacgaatcaggaattctggattgtgctacctacattgctggtctttctggctccacctgg
tacatgtcaaccttgtattctcaccctgattttccagagaaagggccagaggagattaat
gaagaactaatgaaaaatgttagccacaacccccttttacttctcacaccacagaaagtt
aaaagatatgttgagtctttatggaagaagaaaagctctggacaacctgtcacctttact
gatatctttgggatgttaataggagaaacactaattcataatagaatgaatactaccctg
agtagtttgaaggaaaaagtcaatactgcacaatgccctttacctcttttcacctgtctt
catgtcaaacctgacgtttcagagctaatgtttgcagattgggttgaatttagtccatat
gaaattggcatggctaaatatggtacttttatggctcctgacttatttggaagcaaattt
tttatgggaacagttgttaagaagtatgaagaaaaccccttgcatttcttaatgggtgtc
tggggcagtgccttttccatattgttcaacagagttttgggcgtttctggttcacaaagt
agaggctgcacaatggaggaagaattagaaaatattacaacaaagcatattgtgagtaat
gatagttcggacagtgatgatgaatcacacgaacccaaaggcactgaaaatgaagatgct
ggaagggactatcaaagtgataatcaagcaagttggattcatcgtatgataatggccttc
gtgagtgattcagctttattcaataccagagaaggacgtgctgggaaggtacacaacttc
atgctgggcttgaatctcaatacatcttatccactgtctcctttgagtgactttgccaca
caggactcctttgatgatgatgaactggatgcagctgtagcagatcctgatgaatttgag
cgaatatatgaacctctggatgtgaaaagtaaaaagattcatgtagtggacagtgggctc
acctttaacctgccatatcccttgatactgagacctcagagaggggttgatctcatcatc
tcctttgacttttctgcaaggccaagtgactctagtcctccgttcaaggaacttctactt
gcagaaaagtgggctaaaatgaacaagctcccctttccaaagatcgatccttatgtgttt
gatcgggaagggctgaaggagtgctacgtctttaaacccaagaatcctgatatggagcaa
gattgcccaaccatcatccactttgttctggccaacatcaacttcagaaagtacaaggct
ccaggtgttccaagggaaactgaggaagagaaagaaatcgctgactttgatatttttgat
gacccggaatcaccattttcaaccttcaattttcaatatccaaatcaagcattcaaaaga
ctacatgatcttatgcacttcaatactctgaacaacattgatgtgataaaagaagccatg
gttgaaagcatcgaatatagaagacagaatccatctcgttgctctgtttcccttagtaat
gttgaggcaagaaaatttttcaacaaggagtttctaagtaaacccaaagcatag

KEGG   Macaca mulatta (rhesus monkey): 718510
Entry
718510            CDS       T01028                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma isoform X3
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc00565  Ether lipid metabolism
mcc00590  Arachidonic acid metabolism
mcc00591  Linoleic acid metabolism
mcc00592  alpha-Linolenic acid metabolism
mcc01100  Metabolic pathways
mcc04010  MAPK signaling pathway
mcc04014  Ras signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04217  Necroptosis
mcc04270  Vascular smooth muscle contraction
mcc04370  VEGF signaling pathway
mcc04611  Platelet activation
mcc04664  Fc epsilon RI signaling pathway
mcc04666  Fc gamma R-mediated phagocytosis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04921  Oxytocin signaling pathway
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    718510
   00565 Ether lipid metabolism
    718510
   00590 Arachidonic acid metabolism
    718510
   00591 Linoleic acid metabolism
    718510
   00592 alpha-Linolenic acid metabolism
    718510
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    718510
   04014 Ras signaling pathway
    718510
   04370 VEGF signaling pathway
    718510
   04072 Phospholipase D signaling pathway
    718510
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    718510
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    718510
   04664 Fc epsilon RI signaling pathway
    718510
   04666 Fc gamma R-mediated phagocytosis
    718510
  09152 Endocrine system
   04912 GnRH signaling pathway
    718510
   04913 Ovarian steroidogenesis
    718510
   04921 Oxytocin signaling pathway
    718510
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    718510
  09156 Nervous system
   04724 Glutamatergic synapse
    718510
   04726 Serotonergic synapse
    718510
   04730 Long-term depression
    718510
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    718510
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    718510
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     718510
SSDB
Motif
Pfam: PLA2_B
Other DBs
NCBI-GeneID: 718510
NCBI-ProteinID: XP_014979925
Ensembl: ENSMMUG00000014293
LinkDB
Position
19
AA seq 543 aa
MGSSEVSIIPGLQKEEKVAVERRRLHVLKALKKLHIEADEAPVVAVLGSGGGLRAHIACL
GVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLRHRFSRQEWDLAKSL
QKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYPIFAAIDNDLQ
PSWQEAKAQETWFEFTPHHAGFPALGAYVSITHFGSKFKKGRLVRTHPERDLSFLRGLWG
SALGNAEVNRNYIFDQLRNLLTLRGDVWRRTVANAKYIGRRIFAPLLRLQQSLQRERPVL
EDEGGEPNYNWLTEMLENWTRTSLEKQEQPDEDPESKGSVSDFLDFVRKTSICASKWEWG
TTHNFLYKHGGIRDKTMSSRRHLHLVDAGLAINTPFPLVLPPTREVHLILSFDFSAGDPF
ETIRATTDYCRRHKIPFPHVEEAKLDLWSKAPASCYILKGETGPVVMHFPLFNTDACGDD
IEAWSDTYDTFKLADTYTLDVVRPLLALAKMNVRENKKKILREMRNAAMLYYPKHYAQSC
SLV
NT seq 1632 nt   +upstreamnt  +downstreamnt
atgggaagctctgaggtttccataattcctgggctccagaaagaagaaaaggtggctgtg
gagagacgaagacttcatgtgctaaaagctctgaagaagctacatattgaggccgatgag
gccccagttgttgctgtgctgggctcaggcggaggactgcgggctcacattgcctgcctt
ggggtcctgagtgagatgaaagaacagggcctgttggatgctgtcacgtacctcgcaggg
gtctccggatccacttgggcaatatcttctctctacaccaatgatggtgacatggaagct
ctcgaggctgacctgagacatcgatttagccgacaggagtgggacttggctaagagccta
cagaaaaccatccaagcagcgaggtctgagaattactctctgaccgacttctgggcctac
atggttatctccaagcaaaccagagaactgccggagtcccatttgtccaatatgaagaag
cccgtggaagaagggacactaccctacccgatatttgcagccattgacaacgacctacaa
ccctcctggcaggaggcaaaagcacaggagacctggttcgagttcacccctcaccatgct
ggcttccctgcactgggggcctatgtttccataacccactttggaagcaaattcaagaag
ggaagactggtcagaactcaccctgagagagacctgtctttcctgagaggtttatgggga
agtgctcttggtaacgctgaagtcaataggaattatatttttgaccagttaaggaatctt
ctgaccctgagaggagatgtatggagaaggactgttgcaaatgctaaatacattggacgc
cgtatttttgccccgttactgaggctgcaacaaagtttgcaaagggaacgtcctgtcctg
gaagatgaaggcggtgagcctaattacaactggctgactgagatgctcgagaattggacc
aggacctccctggaaaagcaggagcagcccgatgaggaccccgaaagtaaaggctcagtc
agtgactttttggattttgtgagaaaaacaagcatttgcgcttcaaagtgggaatgggga
accactcacaacttcctgtacaaacacggtggcatccgggacaagacaatgagtagccgg
aggcacctccacctggtggatgctggtttagccatcaacactcccttcccacttgtgctg
cccccgacacgggaggttcacctcatcctctcctttgacttcagtgccggagatcctttc
gagaccatccgggctaccactgactattgccgccgccacaagatcccctttccccacgta
gaagaggctaagctggatttgtggtccaaggcccccgccagctgctacatcctgaaagga
gaaaccggaccagtggtgatgcattttcccctgttcaacacagatgcctgtggagatgat
attgaggcatggagtgacacatacgacacattcaagctcgctgacacctacactctagat
gtggtgaggccactcttggcattagccaagatgaacgtcagggaaaacaagaagaagatc
cttagagagatgaggaacgcggccatgctctattacccgaagcattatgcccaaagttgc
tccttggtgtag

DBGET integrated database retrieval system