KEGG   Macaca mulatta (rhesus monkey): 100424899
Entry
100424899         CDS       T01028                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100424899
   04020 Calcium signaling pathway
    100424899
   04072 Phospholipase D signaling pathway
    100424899
   04024 cAMP signaling pathway
    100424899
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100424899
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100424899
  09152 Endocrine system
   04911 Insulin secretion
    100424899
   04922 Glucagon signaling pathway
    100424899
   04923 Regulation of lipolysis in adipocytes
    100424899
   04912 GnRH signaling pathway
    100424899
   04913 Ovarian steroidogenesis
    100424899
   04915 Estrogen signaling pathway
    100424899
   04921 Oxytocin signaling pathway
    100424899
   04926 Relaxin signaling pathway
    100424899
   04935 Growth hormone synthesis, secretion and action
    100424899
   04918 Thyroid hormone synthesis
    100424899
   04928 Parathyroid hormone synthesis, secretion and action
    100424899
   04916 Melanogenesis
    100424899
   04924 Renin secretion
    100424899
   04925 Aldosterone synthesis and secretion
    100424899
   04927 Cortisol synthesis and secretion
    100424899
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100424899
   04270 Vascular smooth muscle contraction
    100424899
  09154 Digestive system
   04970 Salivary secretion
    100424899
   04971 Gastric acid secretion
    100424899
   04972 Pancreatic secretion
    100424899
   04976 Bile secretion
    100424899
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100424899
   04961 Endocrine and other factor-regulated calcium reabsorption
    100424899
  09156 Nervous system
   04724 Glutamatergic synapse
    100424899
   04728 Dopaminergic synapse
    100424899
   04726 Serotonergic synapse
    100424899
   04730 Long-term depression
    100424899
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100424899
  09159 Environmental adaptation
   04713 Circadian entrainment
    100424899
   04714 Thermogenesis
    100424899
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100424899
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100424899
  09165 Substance dependence
   05030 Cocaine addiction
    100424899
   05031 Amphetamine addiction
    100424899
   05032 Morphine addiction
    100424899
   05034 Alcoholism
    100424899
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100424899
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100424899
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100424899
   05165 Human papillomavirus infection
    100424899
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100424899
   05142 Chagas disease
    100424899
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100424899
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100424899
   04031 GTP-binding proteins [BR:mcc04031]
    100424899
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100424899
  Exosomal proteins of other body fluids (saliva and urine)
   100424899
  Exosomal proteins of colorectal cancer cells
   100424899
  Exosomal proteins of bladder cancer cells
   100424899
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    100424899
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 100424899
NCBI-ProteinID: XP_015004195
LinkDB
Position
10
AA seq 245 aa
MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPESPESESDYEHEEADLDLSLPECLEYEEEFDYETESETESEIE
SETDFETEPETAPTTEPETEPEDERGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPP
STQEPQSPSEGEELKPEDKDPRAPEESEEPKKEKQRRRCKPKKPTRRDASPESPSKKGPI
PIRRH
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatcggaggtcccgggctcatcagtggcgccgagctcgccataattacaacgacctg
tgcccacccataggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgtgcccagcagcgcgcggctgcccagcag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggtattccctgagtccccc
gaatcggaatctgactacgagcacgaggaggcagaccttgatctgtcccttcccgagtgc
ctagagtacgaggaagagttcgactacgagaccgagagcgagaccgagtccgaaatcgag
tccgagaccgacttcgagaccgagcctgagaccgcccccaccactgagcccgagaccgag
ccggaagacgagcgcggcccggtggtgcccaagcactccaccttcggccagtccctcacc
cagcgcctgcacgctctcaagttgcgaagccccgacgcctccccaagtcgcgcgccgccc
agcactcaggagccccagagccccagcgagggggaggagctcaagcccgaggacaaagat
ccaagggcccccgaagagtctgaggagcccaagaaggagaagcagcggcgccgctgcaag
cctaagaagcccacccgccgtgacgcgtccccggagtccccttccaaaaagggacccatc
cccatccggcgtcactaa

KEGG   Macaca mulatta (rhesus monkey): 694289
Entry
694289            CDS       T01028                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas isoform X2
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04724  Glutamatergic synapse
mcc04726  Serotonergic synapse
mcc04728  Dopaminergic synapse
mcc04730  Long-term depression
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing syndrome
mcc04935  Growth hormone synthesis, secretion and action
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05012  Parkinson disease
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05032  Morphine addiction
mcc05034  Alcoholism
mcc05142  Chagas disease
mcc05146  Amoebiasis
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    694289
   04020 Calcium signaling pathway
    694289
   04072 Phospholipase D signaling pathway
    694289
   04024 cAMP signaling pathway
    694289
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    694289
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    694289
  09152 Endocrine system
   04911 Insulin secretion
    694289
   04922 Glucagon signaling pathway
    694289
   04923 Regulation of lipolysis in adipocytes
    694289
   04912 GnRH signaling pathway
    694289
   04913 Ovarian steroidogenesis
    694289
   04915 Estrogen signaling pathway
    694289
   04921 Oxytocin signaling pathway
    694289
   04926 Relaxin signaling pathway
    694289
   04935 Growth hormone synthesis, secretion and action
    694289
   04918 Thyroid hormone synthesis
    694289
   04928 Parathyroid hormone synthesis, secretion and action
    694289
   04916 Melanogenesis
    694289
   04924 Renin secretion
    694289
   04925 Aldosterone synthesis and secretion
    694289
   04927 Cortisol synthesis and secretion
    694289
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    694289
   04270 Vascular smooth muscle contraction
    694289
  09154 Digestive system
   04970 Salivary secretion
    694289
   04971 Gastric acid secretion
    694289
   04972 Pancreatic secretion
    694289
   04976 Bile secretion
    694289
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    694289
   04961 Endocrine and other factor-regulated calcium reabsorption
    694289
  09156 Nervous system
   04724 Glutamatergic synapse
    694289
   04728 Dopaminergic synapse
    694289
   04726 Serotonergic synapse
    694289
   04730 Long-term depression
    694289
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    694289
  09159 Environmental adaptation
   04713 Circadian entrainment
    694289
   04714 Thermogenesis
    694289
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    694289
  09164 Neurodegenerative disease
   05012 Parkinson disease
    694289
  09165 Substance dependence
   05030 Cocaine addiction
    694289
   05031 Amphetamine addiction
    694289
   05032 Morphine addiction
    694289
   05034 Alcoholism
    694289
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    694289
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    694289
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    694289
   05165 Human papillomavirus infection
    694289
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    694289
   05142 Chagas disease
    694289
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    694289
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    694289
   04031 GTP-binding proteins [BR:mcc04031]
    694289
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   694289
  Exosomal proteins of other body fluids (saliva and urine)
   694289
  Exosomal proteins of colorectal cancer cells
   694289
  Exosomal proteins of bladder cancer cells
   694289
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    694289
SSDB
Motif
Pfam: G-alpha Arf Roc Gtr1_RagA
Other DBs
NCBI-GeneID: 694289
NCBI-ProteinID: XP_001083221
Ensembl: ENSMMUG00000010266
LinkDB
Position
10
AA seq 1058 aa
MGVRNCLDGNNMSGQRDIPPEIGEQPDQPSLEAPGAAAPGAGPSPAEEMETEPPHNEPIP
IKNDSEACGPPEVSRPNFQVLNQAFREAGAHGSYSPPPEEAMPFEVEQPSLGGFWPTLEQ
PGSPSGAHAGLEAFGPAFMEPGAFSGARPGLGGYSPPPEEAMPFEFDQPAKTGCSQPLLQ
VPDLAPGGPGAAGVPGAPPEEPQALRPPKTGSRGGYSPPPEETMPFELDGEGSGDDSPPP
GLSRVIAQVDRGGQFAAVAASSAVRLTPAANAPPLWVPGAIGSPSREAVRPPPNFTGSGP
PMEISGPPLEIGSAPAGVDDAPVNMDSPPIALDGPPIEVSGAPDKRERAERPPVEEEAAE
MEGSTAADAAEGGKVPSPGYGSPAAGAASTDTATGAARAAPADPDSGAAPEDPDSGAAPA
APADPDSGAAPDAPADPDSGAAPDAPADPDSGAAPDAPADPDSGAAPDAPAVPDAGAAPD
APADPDAGAAPEVPAAPAAAETRAAHVAPAAPDAGAPTAPAASATRAAQAARAASAAPAS
GARRKLHHLRPPSPEIQAADPPTPRPARASAWRGKSERSCGRRVYYDEGAASSDDDSSGD
ESDDGTFGCIRWFQHRRNRRRRKPQRNLLRNFLMQAFGGCFGRSESPQPKASHSSKVKKV
PLVEKRRQMRKEALEKRAQKRAEKKRSKLIDKQLQDEKMGYMCTHRLLLLGAGESGKSTI
VKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPP
VELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQ
YFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQ
CFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDL
LAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGR
HYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgggcgtgcgcaactgcctcgacggcaataatatgtcaggacaacgcgatatcccccct
gaaatcggggaacagcccgatcaaccatctttggaggccccaggggcagctgcccccggt
gctgggcctagcccagccgaagagatggagaccgaaccgcctcacaacgagcccatcccc
atcaagaatgacagcgaggcctgtggacccccagaggtctccaggcccaactttcaggtc
ctcaaccaggcattcagggaagctggagcccatggaagctacagcccacctcctgaggaa
gcaatgcccttcgaggtcgaacagcccagcttgggaggcttctggcctacactggagcag
cctggatcccccagtggggcccatgcaggccttgaggccttcggcccagcattcatggaa
cctggagccttcagtggtgccagaccaggcctgggaggatacagccctccaccagaagaa
gctatgccctttgagtttgaccagcctgccaagacaggctgcagtcaacctctcttacag
gtcccagaccttgctccaggaggcccaggtgctgcaggggtccccggagctcctcccgag
gagccccaagccctcaggcctccaaagactggctccagaggaggctacagccctccccct
gaggagactatgccatttgagcttgatggagaaggatctggggacgacagcccacccccg
gggctttcccgagttatcgcacaagttgaccgcggtggccagttcgcggcagtcgcggcc
tcgagtgcggtccgcctcactcccgccgcgaacgcgcctcccctctgggtcccaggcgcc
atcggcagcccatcccgagaggctgtcagacctcctcctaacttcacgggcagcggcccc
ccgatggagatctccggacccccgctcgagattggcagcgcccccgctggggtcgacgac
gctcccgtcaacatggacagccccccaatcgcgcttgacggcccgcccatcgaggtctcc
ggagccccagataagagagagcgagcagagagacccccagttgaggaggaagcagcagag
atggaaggaagcacagccgctgatgccgcggagggaggaaaagtcccctctccggggtac
ggatcccctgccgccggggcagcttcaacggataccgccaccggggcagcccgtgcagcc
ccagcggatcccgactccggggcagccccagaagatcccgactccggggcagcccctgcc
gccccggccgatcccgactccggggcggcccctgacgccccggccgatcccgactccggg
gcggcccctgacgccccggccgatcccgactccggggcggcccctgacgccccggccgat
cccgactccggggcggcccctgacgccccagcggttccagatgccggggcagcccctgac
gccccagccgatccagatgccggggcagcccctgaggttcccgcggcccctgcggctgct
gagacccgggcagcccatgtcgccccagctgcgcctgacgccggggctcccactgcccca
gccgcttctgccacccgggcagcccaagccgcccgggcggcctcggcagcccctgcctcc
ggggccagacgcaagctccatcaccttagaccccccagccccgagatccaggctgccgat
ccgcctactccgcggcctgctcgcgcgtctgcctggcggggcaagtccgagcgcagctgc
ggccgccgcgtgtactacgatgaaggggcggccagcagcgacgatgactccagcggagac
gagtccgacgatgggaccttcggatgcatccgctggtttcagcatcggcgaaatcgccgc
cgccgaaagccccagcgcaacttactccgcaacttcctcatgcaagccttcgggggctgc
ttcggtcgatctgagagtccccagcccaaagcctcgcactcctccaaggtcaagaaggta
cccctggtggagaagcgcagacagatgcgcaaagaagccctggagaagcgggcccagaag
cgcgcagagaagaaacgcagcaagctcatcgacaaacaactccaggacgaaaagatgggc
tacatgtgtacgcaccgcctgctgcttctaggtgctggagaatctggtaaaagcaccatt
gtgaagcagatgaggatcctgcatgttaatgggtttaatggagagggcggcgaagaggac
ccgcaggctgcaaggagcaacagcgatggtgagaaggcaaccaaagtgcaggacatcaaa
aacaacctgaaagaggcaatcgaaaccattgtggccgccatgagcaacctggtgcccccc
gtggagctggccaaccctgagaaccagttcagagtggactacattctgagtgtgatgaac
gtgcctgactttgacttccctcccgaattctacgagcatgccaaggctctgtgggaggac
gaaggagtacgtgcctgctatgaacgctccaacgagtaccagctgattgactgtgcccag
tacttcctggacaagatcgatgtgatcaagcaggctgactatgtgccgagcgaccaggac
ctgcttcgctgccgcgtcctgacttctggaatcttcgagaccaagttccaggtggacaaa
gtcaacttccacatgtttgacgtgggtggccagcgcgatgaacgccgcaagtggatccag
tgcttcaatgatgtgactgccatcatcttcgtggtggccagcagcagctacaacatggtc
atccgggaggacaaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatc
tggaacaacagatggctgcgcaccatctctgtgattctgttcctcaacaagcaagatctg
ctcgctgagaaagtccttgctgggaaatcgaagattgaggactactttccagaatttgct
cgctacactactcctgaggatgctactcccgagcccggagaggacccacgcgtgacccgg
gccaagtacttcattcgagatgagtttctgaggatcagcactgccagtggagatgggcgt
cactactgctaccctcacttcacctgcgctgtggacactgagaacatccgccgtgtgttc
aacgactgccgtgacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

DBGET integrated database retrieval system