KEGG   Macaca mulatta (rhesus monkey): 100424944
Entry
100424944         CDS       T01028                                 

Gene name
GUCY1B1
Definition
(RefSeq) guanylate cyclase soluble subunit beta-1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04730  Long-term depression
mcc04921  Oxytocin signaling pathway
mcc04924  Renin secretion
mcc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100424944 (GUCY1B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100424944 (GUCY1B1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100424944 (GUCY1B1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100424944 (GUCY1B1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100424944 (GUCY1B1)
   04924 Renin secretion
    100424944 (GUCY1B1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100424944 (GUCY1B1)
  09154 Digestive system
   04970 Salivary secretion
    100424944 (GUCY1B1)
  09156 Nervous system
   04730 Long-term depression
    100424944 (GUCY1B1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100424944 (GUCY1B1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     100424944 (GUCY1B1)
SSDB
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Other DBs
NCBI-GeneID: 100424944
NCBI-ProteinID: NP_001253774
Ensembl: ENSMMUG00000005447
UniProt: A0A1D5QWW9
LinkDB
Position
5
AA seq 619 aa
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt   +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagctgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgcgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctactatctacccaggaatgcgcgcaccttccttt
aggtgcactgatgcagagaagggcaaaggactcattctgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggctcaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctctctgtcttctcactggttcgtcctcat
attgatattagtttccatgggatcctttcgcacatcaatacggtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctgtgttcaccaagtgtcatgaacctggacgatttgacaaggagaggcctgtatcta
agtgacatccctctgcatgatgccacgcgcgatctcgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacatta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctcca
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctcttcagtggcattgtgggcttcaatgctttctgtagcaaacatgcatctgga
gaaggggccatgaagatcgtaaaccttctgaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggtacaagtagatggggaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttggaaataccgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccatttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

KEGG   Macaca mulatta (rhesus monkey): 114673584
Entry
114673584         CDS       T01028                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04730  Long-term depression
mcc04921  Oxytocin signaling pathway
mcc04924  Renin secretion
mcc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    114673584
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    114673584
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    114673584
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    114673584
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    114673584
   04924 Renin secretion
    114673584
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    114673584
  09154 Digestive system
   04970 Salivary secretion
    114673584
  09156 Nervous system
   04730 Long-term depression
    114673584
  09159 Environmental adaptation
   04713 Circadian entrainment
    114673584
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     114673584
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 114673584
NCBI-ProteinID: XP_028693431
LinkDB
Position
17
AA seq 631 aa
MEAILKLFGEYFFQFYKMSGYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMHAPSFRV
ERGADGNMFLHYYSDRSGLCHIVPGIIEAVAKDFFDIEVTMDILDMNEEVERTGKKEHVV
FLKAYRKKRKAKSKRLQDSQGIERDQEALQAAFLRMKEKYLNVSACPVKKHHWDVVRSIV
MFGKGHLVNAFEPIYPERLWIEEKTFCNAFPFHIVFDESLQVKQAGVIIQKYVPGLQTQK
IQLDEYFSIIHPQVTFNIFSICKFINSQFVLKTRREMMPVAWXSQTTLKFRGQMIWMESM
QCMVYLCSLKLRSLYELEXLNMHLSDIXPDDTTRDLILLNQQRLAKIELSNQLEMKKKEE
LRVLSKHLATEKNKTETLLYAMLPKHVANQLREGKKVSAGEFKSCTILFSDVVTFTDIRA
ACEPIHIVNMLNSMYSKFDRLTSVHAVYKVETIGDAYMVVEGVPVPTGSHAQRVANFALG
MRISAKEVMNPVTGEPIQIRVGIHTGSVLAGVVGDKMPQYCLFGDTVNTASRMESHGLPN
KVHLSPTAYSALKNQGFEIIERGEIEVKGKGKMTTYFLIQNLNATEDEIMGRSKTPLDHK
GSTQMVSLPTTKLQDSVQPSCPEHSSLVSWL
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggaagccatcctgaaactctttggagaatacttctttcaattctataagatgtctggc
tatgacaggatgctacggacactgggaggaaatctcatggagtttattgaaaacctggat
gccctccacagttacctggcactctcttatcaggagatgcatgcaccatcgtttcgtgtg
gagagaggagcagatgggaacatgtttctccattactactcagatagaagtggtctgtgc
catattgtaccaggtatcattgaggctgtggccaaagacttctttgacattgaggtaacc
atggacattcttgacatgaatgaagaagtggagaggacagggaagaaggagcatgttgtg
tttctgaaggcttacaggaagaagagaaaggcaaagtcaaaaaggctacaagacagtcag
ggcatcgagagagaccaagaggccctccaggcagctttcctcaggatgaaggagaaatat
ttgaatgtttctgcttgtcctgtgaaaaaacaccactgggatgttgtgagaagcatagtc
atgtttggaaaagggcatctcgtgaatgcctttgagcccatttatcctgagagactctgg
attgaagagaagacattctgcaatgcttttcctttccacattgtatttgatgaatcacta
caggtaaagcaagctggagtgatcattcagaagtacgtgccaggactccaaacccagaag
attcaactggatgagtatttctccatcattcatcctcaagttaccttcaacattttcagc
atctgcaaatttatcaacagtcaatttgtcctgaagacacgaagagaaatgatgcctgta
gcatggtaaagtcagaccacactcaaatttcgaggccagatgatctggatggagtccatg
cagtgcatggtgtacctgtgctctctgaagctccgcagcctgtacgagctggaangactc
aatatgcatctttctgacatcngacctgatgacaccaccagggatctcatcctcctgaac
cagcagcggctggctaagatagagttgtccaaccagctggaaatgaagaagaaggaagag
ctacgggtcctctccaagcacttggccactgaaaagaacaaaacagagaccttgctttat
gccatgctgcccaaacatgtggccaaccagttgagggagggcaaaaaggtgtctgcagga
gaatttaaaagctgcacgattcttttcagcgatgtggtgacatttactgacatccgtgct
gcctgtgaacctatacacatagtgaacatgctgaactccatgtactccaagtttgacaga
ttaaccagtgtgcacgcagtctataaagtagaaacaataggagatgcatatatggtggta
gaaggagtaccagtgcctactggaagccatgctcaaagagtggctaattttgccttgggg
atgagaatttctgcaaaggaagtgatgaatcctgttactggagaacccatccagatcaga
gtggggatccacactggatcagtcttagcaggtgttgtaggagacaagatgccacagtac
tgcttgtttggtgacactgtgaacacagcttctaggatggaaagtcatgggcttcccaac
aaagtgcacctcagccccacagcctacagtgccttaaaaaatcaagggtttgaaatcatt
gagaggggtgaaatcgaagtgaaaggtaaagggaaaatgaccacatactttttgatccag
aacttgaatgccacagaggacgagatcatggggagatctaaaaccccacttgatcacaag
gggtcaacacagatggtgtccctgcccaccaccaagctccaagactcagttcaaccatct
tgccctgaacactcttctcttgtatcctggttatga

KEGG   Macaca mulatta (rhesus monkey): 699365
Entry
699365            CDS       T01028                                 

Gene name
GUCY1A1
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-1 isoform X2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04730  Long-term depression
mcc04921  Oxytocin signaling pathway
mcc04924  Renin secretion
mcc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    699365 (GUCY1A1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    699365 (GUCY1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    699365 (GUCY1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    699365 (GUCY1A1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    699365 (GUCY1A1)
   04924 Renin secretion
    699365 (GUCY1A1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    699365 (GUCY1A1)
  09154 Digestive system
   04970 Salivary secretion
    699365 (GUCY1A1)
  09156 Nervous system
   04730 Long-term depression
    699365 (GUCY1A1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    699365 (GUCY1A1)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     699365 (GUCY1A1)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB
Other DBs
NCBI-GeneID: 699365
NCBI-ProteinID: XP_014994868
Ensembl: ENSMMUG00000023244
LinkDB
Position
5
AA seq 624 aa
MFCTKLKDLKITGECPFSLLAPGQVPNESAEEAAGSSESCKATVPICQDIPEKNIQESLP
QRKTSRSRVYLHTLAESICKLIFPEFERLNLALQRTLAKHKIKESRKSLEREDFEKIIAE
QAVAAGVPVEVIKESLGEELFKICYEEDENILGVVGGTLKDFLNSFSTLLKQSSHCHEAG
KRGRLEDASILCLDKEDDFLHVYYFFPKRTTSLILPGIIKAAAHVLYETEVEVSLMPPCF
HNDCSEFVNQPYLLYSVHVKSTRPSLSPSKPQSSLVIPTSLFCKTFPFHFMFDKDMAILQ
FGNGIRRLMNRRDFQGKPNFEEYFEILTPKINQTFSGIMTMLNMQFVVRVRRWDNSVKKS
SRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQAR
AQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNV
TMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHK
ESDTHAVQIALMALKMMELSDEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNN
VTLANKFESCSVPRKINVSPTTYR
NT seq 1875 nt   +upstreamnt  +downstreamnt
atgttctgcacgaagctcaaggatctcaagatcacaggagagtgtcctttctccctactg
gcaccaggtcaagttcctaatgagtctgcagaggaggcagcaggaagctcagagagctgc
aaagcaaccgtgcccatctgtcaagacattcctgagaagaacatacaagaaagtcttcct
caaagaaaaacgagtcggagccgagtctatcttcacactttggcagagagtatttgcaaa
ctgattttcccagagtttgaacggctgaatcttgcacttcagagaacattggcaaagcac
aaaataaaagaaagcaggaaatctttggaaagagaagactttgaaaaaataattgcagag
caagcagttgcagcaggagttccagtggaagttatcaaagaatctcttggtgaagagctt
tttaaaatatgttacgaggaagatgaaaacatccttggggtggttggaggcactcttaaa
gattttttaaacagcttcagtacccttctgaaacagagcagccattgccatgaagcagga
aaaaggggcagacttgaggacgcctccattctatgcctggataaggaggatgattttcta
catgtttactacttcttccctaagagaaccacctccctgattcttcctggcatcataaag
gcagctgctcacgtattatatgaaaccgaagtggaagtgtcgttaatgcctccctgcttc
cataacgattgcagcgagtttgtgaatcagccctatttgttgtactccgttcacgtgaaa
agcaccaggccatccctgtcccccagcaaaccccagtcctcgctggtgattcccacatcg
ctcttctgcaagacatttccattccatttcatgtttgacaaagatatggcaattctgcaa
tttggcaacggcatcagaaggctgatgaacaggagagactttcaaggaaagcctaatttt
gaagaatactttgaaattctgactcccaaaatcaaccagacatttagcgggatcatgact
atgttgaatatgcagtttgttgtacgggtgaggagatgggacaactctgtgaagaaatct
tcaagggttatggacctcaaaggccaaatgatctacattgttgaatccagtgcaatcttg
tttttggggtcaccctgtgtggacagattagaagattttacaggacgagggctctacctg
tcagacatcccaattcacaatgcactgagggatgtggtcttgataggggagcaagcccga
gctcaagatggcctgaagaagaggctagggaagctgaaggccactcttgagcaagcccac
caagccctagaggaggagaagaaaaagacagtagatcttctgtgctccatatttccctgt
gaggttgctcagcagctgtggcaagggcaagttgtgcaagccaagaagttcagtaatgtc
accatgctcttttcagacatcgttgggttcactgccatctgctcccagtgctcaccgctg
caggtcatcaccatgctcaatgcactctacactcgcttcgaccagcagtgtggagagctg
gatgtctacaaggtggagaccattggcgatgcctattgtgtagctggaggattacacaaa
gagagtgatactcatgctgttcagatagcgctgatggccctgaagatgatggagctctct
gatgaagttatgtctccccatggagaacctatcaagatgcgaattggactgcattctgga
tcagtttttgctggcgttgttggagtcaaaatgccccgttactgtctttttggaaacaat
gtcactctggctaacaaatttgagtcctgcagtgtaccacgaaaaatcaatgtcagccca
acaacttacaggtag

KEGG   Macaca mulatta (rhesus monkey): 706615
Entry
706615            CDS       T01028                                 

Gene name
GUCY1A2
Definition
(RefSeq) guanylate cyclase soluble subunit alpha-2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01100  Metabolic pathways
mcc04022  cGMP-PKG signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04730  Long-term depression
mcc04921  Oxytocin signaling pathway
mcc04924  Renin secretion
mcc04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    706615 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    706615 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    706615 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    706615 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    706615 (GUCY1A2)
   04924 Renin secretion
    706615 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    706615 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    706615 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    706615 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    706615 (GUCY1A2)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     706615 (GUCY1A2)
SSDB
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Other DBs
NCBI-GeneID: 706615
NCBI-ProteinID: XP_002799833
LinkDB
Position
14
AA seq 733 aa
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPPEPSAAAAAAAAAAA
APAPAASAAAAAATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQ
VIGYRDAEKNFHNISNRCSYAEHSNKEEIEDVSGILQCTANILGLKFEEIQERFGEEFFN
ICFHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCRELPEGTLMLHY
FHPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECENT
NITKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVLK
FEDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSI
LFLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERT
HQALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTP
MQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMEL
SEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVS
PTTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVS
YNIGTMFLRETSL
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtccgagtccttcagctccctgggctccgactacctggag
accagcccggaggaggagggggagtgccccctgtctaggctctgctggaatggcagccgg
agcccgcccgggccgccggagcccagcgcggccgccgctgccgctgccgccgccgccgcc
gccccagccccggctgcttctgccgccgccgccgccgccacggccggggccaggagggtg
cagcgccggaggcgggtcaacctggactcgctgggcgagagcatcagccgcctgacggcg
ccctcgcctcagacgatacagcaaactctcaagaggacactgcagtattatgaacatcaa
gttattggttacagggatgcagaaaagaatttccacaatatctctaacagatgctcctat
gcagaacactccaacaaagaagaaatcgaagatgtctcaggaattcttcagtgtactgct
aatatactcggtttgaagtttgaggaaattcaagaaagatttggtgaagagttctttaat
atatgctttcatgagaatgagagagtccttcgagctgtaggtggcactttgcaggacttt
tttaacggctttgatgctttgttggaacacattagaacttcttttggaaaacaggccact
ctggagtcaccctctttcctatgcagagagcttcctgaaggcactctcatgctccactac
ttccaccctcaccatattgtggggtttgcaatgctggggatgattaaggctgcaggaaag
aagatctatcggctggacgtggaagtggaacaggttgcaaatgagaagctatgctctgat
gtttcaaacccaggcaattgtagctgtcttactttccttatcaaagaatgtgaaaatact
aatatcacgaagaaccttccacagggaacctcccaagttcctgcggacctcagaattagc
atcaacaccttctgcagagccttccctttccacttgatgtttgaccccagcatgtcagtc
cttcagctgggggaaggtctaaggaagcagcttcgatgtgacactcacaaagtgctcaag
tttgaggactgcttcgagattgtgtctccaaaggttaatgccacctttgaaagggtccta
ctgcgactgtctaccccgtttgtgattagaaccaagcctgaggcttctggctctgaaaat
aaagacaaggtgatggaagtcaaaggacaaatgatccatgttccggaatcaaattccatt
ttatttttgggctctccatgtgtggacaagttggatgaactcatgggccgagggctacat
ctctcagacatccctatccatgatgccacccgagatgtcattttggttggtgagcaggca
aaggcccaagatggcttgaagaaaaggatggataaattaaaggcaactttagaaagaact
caccaggccctggaagaagagaaaaagaagacagtggatcttctatattctattttccct
ggcgatgtagcccagcaattgtggcaagggcagcaagtacaggccagaaagtttgatgat
gtcaccatgctcttttcagacattgttggcttcacagccatatgtgcccagtgtactccc
atgcaagtaatcagcatgctgaatgaactgtacaccagatttgaccaccagtgtggattt
ttggatatttataaggtggaaacaataggtgatgcctactgtgttgcagcagggctccac
agaaaaagcctctgccatgctaaacccattgctctgatggccttgaagatgatggaactt
tcggaagaggtgctgacacctgatggaagaccaattcagatgaggataggaattcactcg
ggctccgtgctggctggagttgttggggtgcgaatgccacgttattgcctgtttggaaat
aatgtcacgctggcaagcaaattcgagtcaggaagtcaccctcggcgcatcaatgtcagc
ccaaccacttaccaattattaaaacgggaagaaagttttacattcattccgcggtctcgt
gaagagcttccagacaactttccaaaggaaattcctgggatctgctatttcctggaggta
aggactggtccaaagccaccaaagccttctctttcttcgtcgagaataaaaaaggtttcc
tacaacatcggcaccatgttcctccgggagacaagcctctga

DBGET integrated database retrieval system