KEGG   Macaca mulatta (rhesus monkey): 100426259
Entry
100426259         CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100426259
   04015 Rap1 signaling pathway
    100426259
   04072 Phospholipase D signaling pathway
    100426259
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100426259
   05231 Choline metabolism in cancer
    100426259
  09162 Cancer: specific types
   05210 Colorectal cancer
    100426259
   05212 Pancreatic cancer
    100426259
SSDB
Motif
Pfam: RasGEF dUTPase_2
Other DBs
NCBI-GeneID: 100426259
NCBI-ProteinID: XP_028684420
LinkDB
Position
10
AA seq 476 aa
MFSCCVPTCCQPSRCKRGQNKTLSREYRHWFNPHPRSLWPFARRHPQSSTQQIKQELLDG
FHFSIFFKGQVHHATNNGQCWSGYGNEICRMPTFQPGTGEKLLDSLVPALLTKPISSYAT
CLGPSWDFITMPHFLELLVRTTTTSILFTWPLENTSVCYQPPQRSSFRIKLAFRNFAWPG
LGVEDHQELVLGQLVLPEPNEAKPDDPAPHPGQHALTMLALEPAPPLLADLGPALEPESP
AALGAPGYLHSAPAPAPGEGPPPGTLLEPQSAPQSPCPCPVKNQPPEELRDITTFPPRLL
AEQLTLMDAELFKKVVLYECLSCIWGQQQKKQNEHVAPTVRATIAHFNRLTNCVTTSCLG
DHSMRACDRAKVVEHWIKVARECLSLNNFSSVHAIVSALCSNPIHRLHKTWAAVTSKSTK
YLKELCEKDTAVKRDLLIKAGSFKVATQERNPQRAQMRLWRQKKGVVPFLGDFLTV
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgttctcctgctgtgtcccgacgtgctgccaaccttctcgttgcaaaagaggccaaaac
aagactctttcccgagaatatagacattggttcaaccctcaccctcgaagcctctggccc
tttgccagaaggcaccctcagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccatcttctttaaaggacaggtgcaccatgccaccaacaacggccagtgc
tggtctgggtatggaaatgagatctgcaggatgccaactttccagcccggcacaggggag
aagctgttggactccctggttccagccttgctaactaaacccatctcctcctatgccacc
tgcctgggcccctcctgggactttatcaccatgccacactttttggaactactggttaga
accaccacgacctccattttgttcacctggccccttgaaaacacttcagtttgctatcag
cccccacaacggtcatctttccggataaagctggccttcaggaacttcgcctggcctgga
ctgggcgtggaggaccaccaggaacttgtcctaggccagttggtgcttccggagcccaac
gaggccaagccagatgatcctgctccacatcctgggcaacacgcattaacaatgctggcc
ctggagccagcaccaccactgctggcggacctggggcctgctctggagccagaatcacct
gcagccctgggtgcaccaggatatctacattcagcaccagcaccagcaccaggggaaggg
ccccctccagggacactgctggagccacagtcagccccacagtcaccctgtccctgtcct
gtaaagaaccaaccccctgaggagctgcgtgacatcacgaccttccctcccaggctgctg
gcagagcagctgaccctcatggatgcggagctgttcaagaaggtggtgctctacgaatgc
ctcagctgcatctggggtcaacaacagaagaagcagaatgagcacgtggcacccacagtt
cgtgccaccatcgcacacttcaacaggctcaccaactgtgtcaccacctcctgcctcggg
gaccacagcatgagggcctgcgacagggccaaggtggtggagcactggatcaaggtggct
agggagtgcctaagcctcaacaacttctcctcagtgcacgccatcgtctctgctctgtgc
agcaacccaatacatcggctacacaagacgtgggcagcagtgaccagcaaaagcacaaaa
tatctcaaagaactctgcgaaaaagacactgcagtgaagagggacctgctgatcaaggcg
gggagctttaaggtggccacccaggagaggaacccccagagagcccagatgaggctgtgg
aggcagaagaagggcgtggtccccttcctgggggattttctgactgtgtga

KEGG   Macaca mulatta (rhesus monkey): 106992479
Entry
106992479         CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106992479
   04015 Rap1 signaling pathway
    106992479
   04072 Phospholipase D signaling pathway
    106992479
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106992479
   05231 Choline metabolism in cancer
    106992479
  09162 Cancer: specific types
   05210 Colorectal cancer
    106992479
   05212 Pancreatic cancer
    106992479
SSDB
Motif
Pfam: RasGEF PLU-1 dUTPase_2
Other DBs
NCBI-GeneID: 106992479
NCBI-ProteinID: XP_028684454
Ensembl: ENSMMUG00000043049
LinkDB
Position
10
AA seq 560 aa
MFSCCVPTCCRPPRRRRGQNESLSREYRHWFNPHPRRLWPFARRHPQSSTQQIKQELLDG
FHFSIFFRKGQGPTATNHGQCWSGVRQGTEGSPQRDSRKPGCENEICRMPTFQPGTGEKL
LDSLVPALLTKPISSYATCLGPSWDFITVPHFLELLVRRTITCVFFTWPLENTSLCYQPP
QRSSFQIKLAFRNFTRPGLGMEDHQELVLGQLLPPEPNKAQPDDPAPHPGPQALTMPALE
PALLLLAELGPALEPESRAALDAPGYLHSPPAPAPARGSAPATVLEPQSAPESPCSSPVK
NQPTEELPDVTTFPPRLLAEQLTLMDAELFKKVELYECLGSIWGRRTKKGNEHVAPTVHA
TIAHFNRLANCVTTSCLGNHGMRAQDRVTVVEHWIKVARECLSLNNFSAVHAIVSALCSN
PIHRLHETWAAVSSKSTKHLKQLCKTDTAVKRDLLIKAGSFKVATQERNHQRAQMRLQRQ
KKGCVPFLGDFLTVLQRLDSAIPDDLDEVRVLQEMQLLQVAAMNYRLRPLEKFVTYFKRM
EQLSDKESYKLSCQLEPKSQ
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgttctcctgctgtgtcccgacgtgctgccgacctcctcgtcgcagaagaggccaaaat
gagagtctttctcgagaatatagacattggttcaaccctcaccctcgacgcctctggccc
tttgccagaaggcaccctcagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccatcttcttcagaaaaggacaggggcccaccgccaccaaccatggccag
tgctggtctggggtgagacagggcacagaagggtctccacagagggactccagaaaacca
gggtgtgaaaatgagatctgcaggatgccaactttccagcccggcacaggggagaagctg
ttggactccctggttccagccttgctaactaaacccatctcctcctatgccacctgcctg
ggcccctcctgggactttatcaccgtgccacactttttggaactactggttagaagaacc
atcacctgcgttttcttcacctggccccttgaaaatacttcactgtgctatcagcccccg
caacggtcatctttccagataaagctggccttcaggaacttcaccaggcctggactgggc
atggaggaccaccaggaacttgtcctaggccagttgctgcctccggagcccaacaaggcc
cagccagatgatcctgctccacatcctgggccacaggcattaacaatgccggccctggag
ccagcactactactgctggcggaactggggcctgctctggagccagagtcacgtgcggcc
ctggatgcaccaggatatctacattcaccaccagcaccagcaccagccagagggtctgct
cccgcgacagtgctagagccacagtcagccccagagtccccctgttcctctcctgtaaag
aaccaacccactgaggagctgcctgatgtcacgaccttccctcccaggctgctggcagag
cagctgacccttatggatgcggagctgttcaagaaggtggagctctacgaatgtttgggc
tccatctggggccgacgaactaagaaagggaatgagcacgtggcacccacagttcatgct
accatcgcacacttcaacaggctcgccaactgcgtcaccacctcctgcctcgggaaccat
ggcatgagggcccaggacagggtcacggtggtggaacactggatcaaagtggccagagag
tgcctaagcctcaacaacttctccgcggtgcacgccattgtttctgctctgtgcagcaac
ccaatacatcggctacacgagacatgggcagcagtgtccagcaaaagcacaaaacatcta
aaacaactctgcaaaacagacactgcagtgaagcgggacctgctgatcaaggcggggagc
tttaaggtggccacccaggagaggaaccaccagagagcccagatgaggctacagaggcag
aagaaggggtgtgtccccttcctgggggattttctgactgtgttacagaggttggattcg
gccatcccggacgatctggatgaggtccgagttctgcaggaaatgcagctgctccaagtg
gctgccatgaattacaggcttcggcctcttgagaaatttgtcacctatttcaaaagaatg
gagcagctcagtgacaaggagagctacaagctttcctgccagctggagcccaaatcccag
tag

KEGG   Macaca mulatta (rhesus monkey): 106995478
Entry
106995478         CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106995478
   04015 Rap1 signaling pathway
    106995478
   04072 Phospholipase D signaling pathway
    106995478
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106995478
   05231 Choline metabolism in cancer
    106995478
  09162 Cancer: specific types
   05210 Colorectal cancer
    106995478
   05212 Pancreatic cancer
    106995478
SSDB
Motif
Pfam: RasGEF dUTPase_2
Other DBs
NCBI-GeneID: 106995478
NCBI-ProteinID: XP_028698852
LinkDB
Position
Unknown
AA seq 553 aa
MFSCCVPTCCRPPRRRRGQNESLSREYRHWFNPHPRRLWPFARRHPQSSTQQIKQELLDG
FHFSIFFKEGQGPPATNHGQCWSGYENEICRMPTFQPSTGEKLLESLVPAFLTKPISSYA
TCLGPSWDFITVPHFLELLVRSTTTSILFTWPPENTSVCCQALQRSSFWIKLAFRTFAWP
GLGVEDHQEIVLGQLVLPEPKEAKPDDPAPPPGQHALTMLALEPAPPLLADLRPALEPES
PVALDAPGYLHSASAPAPGEGPPPGTVLEPQSAPESPCPCPGTVQSQHTEELPDITTFPP
RLLAEQLTLMDADLFKKVELYECLGSIWGQRHQKGSEHVAPTVCATIAHFNRLANCVTTS
CLGDHSMRVQDRARVVEHWIKVARECLSLNNFSSVHAIVSALRSNPIHRLHKTWAAVSSK
SSKYLKELCKKDTAVKRDLLIKAGSFKVATQERNPQRAQMRLQRQKKGVVPFLGDFLTEL
HRLDSAIPDDLDGNTNKRRKEVRVLQELQLLQVAAMNYRLQPLEKFVTCFSRMEQLSDKE
SHKLSCQLEPESQ
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgttctcttgctgtgtcccgacgtgctgtcgacctcctcgtcgcagaagaggccaaaat
gagagtctttctcgagaatatagacattggttcaatcctcaccctcgacgcctctggcca
tttgccagaaggcacccacagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccatcttcttcaaagaagggcaggggccgcctgctaccaaccatggccag
tgctggtctgggtatgaaaatgagatctgcaggatgccaactttccagcccagcacaggg
gagaagctattggagtccctggttccagcctttctaactaaacccatctcctcctatgcc
acctgcctgggtccctcctgggactttatcaccgtgccacactttttggaactactggtt
agaagcaccaccacctccattttgttcacctggccccctgaaaacacctcagtttgctgc
caggccctgcaacggtcatctttctggataaagctggccttcaggaccttcgcctggcct
ggactgggcgtggaggaccatcaggaaattgtcctaggccagttggtgcttccggagccc
aaggaggccaagccagatgatcctgctccacctcctgggcaacacgcattaacaatgctg
gccctggagccagcaccaccactgctggcggacctgcggcctgctctagagccagagtca
cctgtagccctggatgcaccaggatatctacattcagcatcagcaccagcaccaggggaa
gggccccctccaggaacagtgctggagccacagtcagccccagagtcaccctgtccctgt
cccgggactgtccagagccaacacactgaggagctgccggacatcacgaccttccctccc
aggctgctggctgagcagctgacccttatggatgcggatctgttcaagaaggtggagctc
tacgaatgcttgggctccatctggggccaacgacatcagaaggggagtgagcacgtggca
cccacagtttgtgccaccattgcacacttcaacaggctcgccaactgtgtcaccacctcc
tgcctcggggaccacagcatgagggtccaggatagggccagggtggtggagcactggatc
aaggtggccagggagtgcctaagcctcaacaacttctcctcagtgcacgccatcgtctct
gctctgcgcagcaacccaatacatcggctacacaagacgtgggcagcagtgtccagcaaa
agctcaaaatatctaaaagaactctgcaaaaaagacactgcagtgaagagggacctgctg
atcaaggcggggagctttaaggtggccacccaggagaggaacccccagagagcccagatg
aggctacagaggcagaagaagggcgtggtccccttcctgggggattttctgactgagtta
cacaggttggattcagccatcccggatgatctggatggcaacaccaacaagaggagaaag
gaggtccgagttctgcaggaattgcagctactccaagtggctgccatgaattacaggctt
cagcctctggagaaatttgtcacttgtttctcaagaatggagcagctcagtgacaaggag
agccacaagctgtcctgtcagctggagcccgaatcccagtag

KEGG   Macaca mulatta (rhesus monkey): 106995524
Entry
106995524         CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106995524
   04015 Rap1 signaling pathway
    106995524
   04072 Phospholipase D signaling pathway
    106995524
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106995524
   05231 Choline metabolism in cancer
    106995524
  09162 Cancer: specific types
   05210 Colorectal cancer
    106995524
   05212 Pancreatic cancer
    106995524
SSDB
Motif
Pfam: RasGEF dUTPase_2
Other DBs
NCBI-GeneID: 106995524
NCBI-ProteinID: XP_028684477
LinkDB
Position
10
AA seq 555 aa
MFSCCVPTCCRPPRRRRGQNETVSREYRHWYNPHPRRLWPFARRHPQSSTQQIKQELLDG
FHFSTFFKEGQGPPATNHGQCWSAYENEICRMPTFQPGTGEKLLESLVPAFLTKPISSYA
TCLGPSWDFITVPHFLELLVRSTTTSILFTWPPENTSVCCQALQRSSFWIKLAFRTFTWP
GLGLEDHQEIVLGQLVLPEPKEAKPEDPAPPPGQHPSTILALEPAPPLLADLRPALEPES
PVALDAQGYLHSPPAPAPAPGEGPPPGTVLEPQSASESPCPSPRTVKSQLSEELPDITTF
PPRLLAEQLTLIDADLFKKVELYECLGSIWGQRHQKGSEHVAPTVCATITHFNRLTNCVT
TSCLGDHSMRAQDRARVVEHWIKVARECLRLNNFSAVHAIVSALRSNPIHRLHKTWAAVT
SKSTKYLKELCKKDTAVKRDLLIKAGSFKVATQERNPQRAQMRLRRQKKGVVPFLGDFLT
ELHRLDSAIPDDLDGNSNKRRKEVRVLQEMQLLQVAAMNYRLRPLEKFVTCFSRMEQLSD
KESYKLSCQLEPESQ
NT seq 1668 nt   +upstreamnt  +downstreamnt
atgttctcctgttgtgtccccacatgctgccgacctcctcgtcgcagaagaggacaaaat
gagactgtttctcgagaatacagacattggtacaaccctcaccctcgacgcctctggccc
tttgccagaaggcacccacagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccaccttcttcaaagaagggcaggggccgcctgctaccaaccacggccag
tgctggtctgcgtatgaaaatgagatctgcaggatgccaactttccagcccggcacaggg
gagaagctgttggagtccctggttccagcctttctaactaaacccatctcctcctatgcc
acctgcctgggtccctcctgggactttatcaccgtgccacactttttggaactactggtt
agaagcaccaccacctccattttgttcacctggccccctgaaaacacttcagtttgctgc
caggccctgcaacggtcatctttctggataaagctggccttcaggaccttcacctggcct
ggactgggcttggaagaccatcaggaaattgttttaggccagttggtgcttccggagccc
aaggaggccaagccagaagatcctgctcctcctcctgggcaacacccatcaacaatactg
gccctggagccagcaccaccactgctggcggacctgcggcctgctctggagccagagtca
cctgtagccctggatgcacaaggatatctacattcaccaccagcaccagcaccagcacca
ggggaagggccccctccaggaacagtgctggagccacagtcagcctcagagtccccctgt
ccctctccccggacagtcaagagtcaactcagtgaggagctgccggacatcacgaccttc
cctcccaggctgctggcagagcagctgaccctcatagatgcggatctcttcaagaaggtg
gagctctacgaatgcttgggctccatctggggccaacgacatcagaaggggagtgagcac
gtggcacccacagtttgtgccaccattacacacttcaacaggctcaccaactgtgtcacc
acctcctgcctcggggaccacagcatgagggcccaggacagggccagggtggtggagcac
tggatcaaagtggccagggagtgcctacgcctcaacaacttctccgcggtgcacgccatc
gtctctgctctgcgcagcaacccaatacatcggctacacaagacgtgggcagcagtgacc
agcaaaagcacaaaatatctaaaagaactctgcaaaaaagacactgcagtgaagagggac
ctgctgatcaaggcggggagctttaaggtggccacccaggagaggaacccccagagagcc
cagatgaggctacggaggcagaagaagggcgtggtcccctttctgggggattttctgact
gagttacacaggttggattcggccatcccggatgatctggatggcaacagcaacaagagg
aggaaggaggtccgagttctgcaggaaatgcagctgctccaagtggctgccatgaattac
aggcttcggcccctggagaaatttgtcacttgtttctcaagaatggagcagctcagtgac
aaggagagctacaagctgtcctgtcagctggagcccgaatcccagtag

KEGG   Macaca mulatta (rhesus monkey): 114670406
Entry
114670406         CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    114670406
   04015 Rap1 signaling pathway
    114670406
   04072 Phospholipase D signaling pathway
    114670406
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114670406
   05231 Choline metabolism in cancer
    114670406
  09162 Cancer: specific types
   05210 Colorectal cancer
    114670406
   05212 Pancreatic cancer
    114670406
SSDB
Motif
Pfam: RasGEF dUTPase_2
Other DBs
NCBI-GeneID: 114670406
NCBI-ProteinID: XP_028683868
LinkDB
Position
10
AA seq 553 aa
MFSCCVPTCCRPPRRRRGQNETVSREYRHWYNPHPRRLWPFARRHPQSSTQQIKQELLDG
FHFSIFFKEGQGPPATNHGQCWSGYENEICRMPTFQPSTREKLLESLVPAFLTKPISSYA
TCLGPSWDFITVPHFLELLVRSTTGSILFTWPPENTSVCGQALQRSSFWIKLAFRTFTWP
GLGLEDHQGIVLGQLVLPEPKEAKPDDPAPPPGQHALTMLALEPAPPLLAELPPALEPES
PVALDAQGYRHSTPAPAPGEGPPPGTVLEPQSAPESPCPCPGTVKSQHTEERPDITTFPP
RLLAEQLTLIDAELFKKVELYECMGSIWGQRHQKWSEHVAPTVCATIAHFNRLTNCVTTS
CLGDHSMRAQDRARVVEHWIKVARECLRLNNFSSVHAIVSALRSNPIYRLHKTWAGVSSK
STKYLKELCKKDTAVKRDLLIKAGSFKVATQERNPQRAQMRLRRQNKGVVPFLGDFLTEL
HRLDSAIPDDLDGNSNKRRKEVRVLQEMQLLQVAAMNYRLRPLEKFVTCFSRMEQLSEKE
SYKLSCQLEPESQ
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgttctcctgctgtgtcccaacatgctgccgacctcctcgtcgcaggagaggccaaaat
gagactgtttctcgagaatatagacattggtacaaccctcaccctcgacgcctctggccc
tttgccagaaggcacccacagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccatcttcttcaaagaagggcaggggccccctgctaccaaccacggccag
tgctggtctgggtatgaaaatgagatctgcaggatgccaactttccagcccagcacaagg
gagaagctgttggagtccctggttccagcctttctaactaaacccatctcctcctatgcc
acctgcctgggtccctcctgggactttatcaccgtgccacactttttggaactactggtt
agaagcaccaccggctccattttgttcacctggccccctgaaaacacttcagtttgcggc
caggccctgcaacggtcatctttctggataaagctggccttcaggaccttcacctggcct
ggactgggcttggaggaccatcagggaattgtcctaggccagttggtgcttccggagccc
aaggaggccaagccagatgatcctgctccacctcctgggcaacacgcattaacaatgctg
gccctggagccagcgccaccactgctggcggaactgccgcctgctctggagccagagtca
cctgtagccctggatgcacaaggatatcgacattcaacaccagcaccagcaccaggggaa
gggccccctccaggaacagtgctggagccacagtcagccccagagtcaccctgtccctgt
cccgggactgtcaagagccaacacactgaggagcggcctgacatcaccaccttccctccc
aggctgctggcagagcagctgaccctcatagatgcggagctgttcaagaaggtggaactc
tacgaatgcatgggctccatctggggccaacgacatcagaagtggagtgagcacgtggca
cccacagtttgtgccaccattgcacacttcaacaggctcaccaactgtgtcaccacctcc
tgcctcggggaccacagcatgagggcccaggacagggccagggtggtggagcactggatc
aaggtggccagggagtgcctacgcctcaacaacttctcctcagtgcacgccatcgtctct
gctctgcgcagcaacccaatatatcggctacacaagacgtgggcaggagtgtccagcaag
agcacaaaatatctaaaagaactctgcaaaaaggacactgcagtgaagagggacctgctg
atcaaggcggggagctttaaggtggccacccaggagaggaacccccagagagcccagatg
aggctgcggaggcagaataagggcgtggtccccttcctgggggattttctgactgagtta
cacaggttggattcggccatcccggatgatctggatggtaacagcaacaagaggaggaag
gaggtccgagttttgcaggaaatgcagctgctccaagtggctgccatgaattacaggctt
cggcctctggagaaatttgtcacttgtttctcaagaatggagcagctcagtgaaaaggag
agctacaagctgtcctgtcagctggagcccgaatcccagtag

KEGG   Macaca mulatta (rhesus monkey): 710293
Entry
710293            CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein isoform X2
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    710293
   04015 Rap1 signaling pathway
    710293
   04072 Phospholipase D signaling pathway
    710293
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710293
   05231 Choline metabolism in cancer
    710293
  09162 Cancer: specific types
   05210 Colorectal cancer
    710293
   05212 Pancreatic cancer
    710293
SSDB
Motif
Pfam: RasGEF dUTPase_2
Other DBs
NCBI-GeneID: 710293
NCBI-ProteinID: XP_001097285
LinkDB
Position
10
AA seq 553 aa
MFSCCVPTCCRPPRRRRGQNESLSREYRHWFNPHPRRLWPFARRHPQSSTQQIKQELLDG
FHFSTFFKEGQGPPATNHGQCWSGYENEICRMPTFQSGIGEKLLESLVPAFLTKPISSYA
TCLGPSWDFITVPHFLELLVRSTTTSILFTWPPENTSVCYQPPQQSSFWIKLAFRNFAWP
GLGLEDHQELVLGQLVLPEPNEAKPDDPAPPPGQHALTMLALEPAPPLLADLGPALEPES
GAALGAPGYLHSAPAPAPGEGPPPGTSLEPQSAPEAPCPCPGTVQSQHTEELPDITTFPP
RLLAEQLTLMDAELFKKVVLYECLGSIWGQRHKKGSEHVAPTVRATIAHFNRLTNCVTTS
CLGDHSMRARDRARVVEHWIKVARECLSLNNFSSVHAIISALRSNPIHRLHKTWAGVSSK
SSKYLKELCKKDTAVKRDLLIKAGIFKVATQERNPQRAQMRLQRQNKGVVPFLGDFLTEL
HRLDSAIPDDLDGNSNKRRKEVRVLQEMQLLQVASMNYKLRPLEKFVTCFSRMEQLSDKE
SYKLSCQLEPESQ
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgttctcctgctgtgtcccgacgtgctgccgacctcctcgtcgcagaagaggccaaaac
gagagtctttcccgagaatatagacattggttcaaccctcaccctcgacgcctctggcca
tttgccagaaggcacccacagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccaccttcttcaaagaagggcaggggccccctgctaccaaccacggccag
tgctggtctgggtatgaaaatgagatctgcaggatgccaactttccagtccggcataggg
gagaagctgttggagtccctggttccagcctttctaactaaacccatctcctcctatgcc
acctgcctaggcccctcctgggactttatcaccgtgccacactttttggaactactggtt
agaagcaccaccacctccattttgttcacctggccccctgaaaacacttcagtttgctat
cagcccccgcaacaatcatctttctggataaagctggccttcaggaacttcgcctggccc
ggactgggcttggaggaccaccaggaacttgtcctaggccagttggtgcttccggagccc
aacgaggccaagccagatgatcctgctccgcctcctgggcaacacgcattaacaatgctg
gccctggagccagcaccaccactgctggcggacctggggcctgctctggagccagagtca
ggtgcagccctgggtgcaccaggatatctacattcagcaccagcaccagcaccaggggaa
gggccccctccagggacatcactggagccacagtcagccccagaggccccctgtccctgt
cccgggactgtccagagccaacacactgaggagctgccggacatcacgaccttccctccc
aggctgctggctgagcagctgaccctcatggatgcggagctgttcaagaaggtggtgctc
tacgaatgtttgggctccatctggggccaacgacataagaaggggagtgagcatgtggca
cccacagttcgtgctaccatcgcacacttcaacaggctcaccaactgcgtcaccacctcc
tgccttggggaccacagcatgagggcccgggacagggccagggtggtggagcactggatc
aaggtggccagggagtgcctaagcctcaacaacttctcttcagtacacgccatcatctct
gctctgcgcagcaacccaatacatcggctacacaagacgtgggcaggagtgtccagcaaa
agctcaaaatatctaaaagaactctgcaaaaaagacactgcagtgaagagggacctgctg
atcaaggcggggatctttaaggtggccacgcaggagaggaacccccagagagcccagatg
aggctgcagaggcagaataagggcgtggtccccttcctgggggattttctgactgagtta
cacaggttggattcggccatcccggacgatctggatggcaacagcaacaagaggagaaag
gaggtccgagttctgcaggaaatgcagctgctccaagtggcttccatgaattacaaactt
cggcctctggagaaatttgtcacttgtttctcaagaatggagcagctcagtgacaaggag
agctacaagctgtcctgccagctggagcccgaatcccagtag

KEGG   Macaca mulatta (rhesus monkey): 710997
Entry
710997            CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    710997
   04015 Rap1 signaling pathway
    710997
   04072 Phospholipase D signaling pathway
    710997
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    710997
   05231 Choline metabolism in cancer
    710997
  09162 Cancer: specific types
   05210 Colorectal cancer
    710997
   05212 Pancreatic cancer
    710997
SSDB
Motif
Pfam: RasGEF
Other DBs
NCBI-GeneID: 710997
NCBI-ProteinID: XP_028698849
LinkDB
Position
Unknown
AA seq 460 aa
MPTFQPGTGEMLLDSLVPALLTKPISSYATCLGPSWDFITVPHFLELLVRRTITCVFFTW
PLENTSLCYQPPQRSSFQIKLAFRNFTRPGLGVEDHQELVLGQLLPPEPNEAKPDDPAPH
PGPHALTMPALEPAPPLLVELGPALEPESRAAPDAPGYLHSPPAPAPGEGSAPVTVLEPQ
SAPESPCSSPVNSQPTEELPDVTTFPPRLLAEQLTLMDAELFKKVELYECLGSIWGRRAK
KGNEHVAPTVRATIAHFNRLANCVTTSCLGNHGMRAQDRARVVEHWIKVARECLSLNNFS
SVHAIVSALCSNPIHRLHKTWAAVSSKSTKYLKQLCKTDTAVKRDLLIKAGSFKVATQER
NHQRAQMRLRRQKKGAVPFLGDFLTVLQRLDSAIPDDLDGNINKKRKEVRVLQEMQLLQV
AAMNYRLRPLEKFVTYFKRLEQLSDKESYKLSCQLEPKSQ
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgccaactttccagcccggcacaggggagatgctgttggactccctggttccagccttg
ctaactaaacccatctcctcctatgccacctgcctgggcccctcctgggactttatcacc
gtgccacactttttggaactgctggttagaagaaccatcacctgcgttttcttcacctgg
ccccttgaaaatacttcactgtgctatcagcccccgcaacggtcatctttccagataaag
ctggccttcaggaacttcaccaggcctggactgggcgtggaggaccaccaggaacttgtc
ctaggccagttgctgcctccggagcccaacgaggccaagccagatgatcctgctccacat
cctgggccacacgcattaacaatgccggccctggagccagcaccaccactgctggtggaa
ctggggcctgctctggagccagagtcacgtgcggccccagatgcaccaggatatctacat
tcaccaccagcaccagcaccaggcgaagggtctgctccagtgacagtgctagagccacag
tcagccccagagtccccctgttcctctcctgtaaacagccaacccactgaggagctgcct
gatgtcacgaccttccctcccaggctgctggcagagcagctgacccttatggatgcggag
ctgttcaagaaggtggagctctacgaatgtttgggctccatctggggccgacgagctaag
aaggggaatgagcacgtggcacccacagttcgtgccaccatcgcacacttcaacaggctc
gccaactgcgtcaccacctcctgcctcgggaaccacggcatgagggcccaggacagggcc
agggtggtggagcactggatcaaggtggccagggagtgcctaagcctcaacaacttctcc
tcggtgcacgccatcgtctctgctctgtgcagcaacccaatacatcggctacacaagaca
tgggcagcagtgtccagcaaaagcacaaaatatctaaaacaactctgcaaaacagacact
gcagtgaagcgggacctgctgatcaaagcggggagctttaaggtggccacccaggagagg
aaccaccagagagcccagatgaggctacggaggcagaagaagggtgcggtccccttcctg
ggggattttctgactgtgttacagaggttggattcggccatcccggacgatctggatggc
aacatcaacaagaagaggaaggaggtccgagttctgcaggaaatgcagctgctccaagtg
gctgccatgaattacaggcttcggcctcttgagaaatttgttacctatttcaaaagactg
gagcagctcagtgacaaggagagctacaagctttcctgccagctggagcccaaatcccag
tag

KEGG   Macaca mulatta (rhesus monkey): 711158
Entry
711158            CDS       T01028                                 

Definition
(RefSeq) ral-GDS-related protein-like isoform X1
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    711158
   04015 Rap1 signaling pathway
    711158
   04072 Phospholipase D signaling pathway
    711158
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    711158
   05231 Choline metabolism in cancer
    711158
  09162 Cancer: specific types
   05210 Colorectal cancer
    711158
   05212 Pancreatic cancer
    711158
SSDB
Motif
Pfam: RasGEF dUTPase_2
Other DBs
NCBI-GeneID: 711158
NCBI-ProteinID: XP_014984271
Ensembl: ENSMMUG00000047015
LinkDB
Position
10
AA seq 552 aa
MFSCCVPTCCRPPRRRRGQNESLSREYRHWFNPHPRRLWPFARRHPQSSTQQIKQELLDG
FHFSNFFKEGQGPTATKHGQCCSGYENEICRMSTFQPGTGEKLLDSLVPAFLTKPISSYA
TCLGPSWDFITVPHFLELLVRSTITSILFTWPLENSSVCYQPPQRSSFRIKLAFRNFAWP
GLGVEDHQELVLGQLVLPEPNEAKPDDPAPPPGQHALTMPALEPAPPLLADVGPALEPES
GAALGAPGYLYSAPGPAPGEGSPPATLLEPQSASESPSPSSGTVKNQLEEMPDITTFPPR
LLAEQLTCMDVELFKKVELYECLGSIWGQRAKEGNEYVAPTVHATIAHFNRLTNCVTTSC
LRNHGMTGRDRARVVEHWIKVARECLSLNNFSSVHAIVSALCSKPIHRLHETWAAVSSKS
TKHLKQLCEKDTAVKRDLLIKAGSFKVATQERNPQRAQMRLRRQNKGVVPFLGDFLTELH
RLDTAIPDDLDGNSNKRRKEVRVLQEMQLLQVAAMNYRLRPLEKFVTYFPRMEQLSDKES
YKLSCQLEPESQ
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgttctcttgctgtgtccccacatgctgccgacctcctcgtcgcagaagaggacaaaat
gagagtctttctcgagaatatagacattggttcaaccctcaccctcgacgcctctggccc
tttgccagaaggcacccacagagctccacacagcagatcaagcaggagctgttggatgga
ttccatttctccaacttcttcaaagaagggcaggggcccaccgccaccaaacacggccag
tgctgctctgggtatgaaaatgagatctgcaggatgtcaactttccagcccggcacaggg
gagaagctgttggactccctggttccagcctttctaactaaacccatctcctcctatgcc
acctgcctgggcccctcctgggactttatcaccgtgccacactttttggaactactggtt
agaagcaccatcacctccattttgttcacctggccccttgaaaactcttcagtttgctat
cagcccccacaacggtcatctttccggataaagctggccttcaggaacttcgcctggcct
ggactgggcgtggaggaccatcaggaacttgtcctaggccagttggtgcttccggagccc
aacgaggccaagccagatgatcctgctccacctcctgggcaacacgcattaacaatgccg
gccctggagccagcaccaccactgctggcggacgtggggcctgctctggaaccagagtca
ggtgcagccctgggtgcaccaggatatctatattcagcaccaggaccagcaccaggggaa
gggtcccctccagcaacactgctggagccacagtccgcctcagagtcccccagtccctct
tctgggactgtgaagaaccaacttgaggagatgcctgacatcacgaccttccctcccagg
ctgctggcagagcagctgacctgcatggatgtggagctgttcaagaaggtggagctctac
gaatgcttgggctccatctggggtcaacgagctaaggaggggaatgagtacgtggcaccc
acagttcatgcgaccatcgcacacttcaacaggctcaccaactgcgtcaccacctcctgc
ctcaggaaccatggcatgacaggccgggacagggccagggtggtggagcactggatcaag
gtggccagggagtgcctaagcctcaacaacttctcctcggtgcacgccatcgtctctgct
ctgtgtagcaaaccaatacatcggctacacgagacatgggcagcagtgtccagcaaaagc
acaaaacatctaaaacaactctgcgaaaaagacactgccgtgaagagggacctgctgatc
aaggcggggagctttaaggtggccacccaggagaggaacccccagagagcccagatgagg
ctgcggaggcagaataagggagtggtccccttcctgggagattttctgactgagttacac
agattggatacggccatcccagacgatctggatggcaacagcaacaagaggaggaaggag
gtccgagttctgcaggaaatgcagctgctccaagtggctgccatgaattacaggcttcgg
cctcttgagaaatttgtcacctatttcccaagaatggagcagctcagtgacaaggagagc
tacaagctgtcctgccagctggagcccgaatcacagtag

KEGG   Macaca mulatta (rhesus monkey): 714436
Entry
714436            CDS       T01028                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X4
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05212  Pancreatic cancer
mcc05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    714436 (RALGDS)
   04015 Rap1 signaling pathway
    714436 (RALGDS)
   04072 Phospholipase D signaling pathway
    714436 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714436 (RALGDS)
   05231 Choline metabolism in cancer
    714436 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    714436 (RALGDS)
   05212 Pancreatic cancer
    714436 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 714436
NCBI-ProteinID: XP_014971944
Ensembl: ENSMMUG00000015274
LinkDB
Position
15
AA seq 901 aa
MVQRMWAEAAGPVGGAEPLFPGSRRSRSVWDAVRLEVGVPDSCPVVLHSFTQLDPDLPRP
ESSTQEIGEELINGVIYSISLRKVQLHHGANKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQQVLDLLFKRYGCVLPYSDEDGGPQDQ
LKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERRAHLLLAQLEHSE
PTEAEPEALSPVPALKPTPELELALTPARAPSPVPAPAPAPTPAPGSELEVAPAPAPKLQ
QAPEPAVELEPAPAPALELEPAPVPPPEQDPAPSQTLELEPTLVPVPALEPSWPSPVVAE
NGLSEKPHLLVFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKGKEHLAPTIRAT
VTQFNSVANCVITTCLGDRSTKAPDRARVVEHWIEVARECRILKNFSSLYAILSALQSNS
IHRLKKTWEDVSRDSFRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRAQKR
PKETGIIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKLLQSACN
NYSITPDEQFGVWFRALERLSETESYNLSCELEPPSESASNTLRTKKNTAIVKRWSDRQA
PSTELSTSGSSHSKSCDQLRCGPYLSSGDIADALSVHSAGSSSSDVEEINISFVPESPDG
QEKKFWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVSGLCNSSSALPLYN
QQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLEEDEPEDYELLQILS
DDRKLKIPENANVFYAMNSTANYDFVLKKRAFTKGVKVKHGASSTLPRMKQKGLKIAKGI
F
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcggccgggcctgttggcggcgccgagccgctgttt
ccgggctcccggcggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcgtcccc
gacagctgcccggtggtgctgcacagcttcacgcagctcgaccccgacctgccgcgcccg
gagagctccacgcaggagatcggtgaggagctgatcaacggagtcatctactccatctcc
ctgcgcaaggtgcagctgcaccacggagccaacaagggccagcgctggctcgggtatgag
aatgagtcggccctgaacctttatgagacttgcaaggtgcggaccgtgaaggctggcacg
ctggagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctacgtc
accatcttcctgtgtacctacagagccttcaccaccacccaacaggtcctggacctgctg
tttaaaagatacggctgcgtcctcccctattccgacgaggatggcggaccccaggaccaa
cttaaaaatgccatctcctccatcctgggcacctggctggaccagtactcggaggatttc
tgtcaacccccggactttccctgcctcaagcagctggtggcctatgtgcagctcaacatg
ccaggctcagacctggagcgccgtgcccaccttctcctggcccagctggagcactcggaa
cccactgaggcagagcctgaggctctgtcaccagtgccagctctaaaaccaactccagag
ctagagctagctctaacaccagctcgagcacccagcccagtgccagccccagcgccagct
ccaacaccagctccaggctcagagctagaggtcgctccagcaccagctccgaagctccag
caggctccagagccagctgtggaactagaaccggctccagcgccagctctggaactagag
ccagctccagtaccacctccagaacaggatccagctccttcccaaactctagagctggag
ccaactctagtgccagttccagcattagagccttcctggccttcacctgtggttgcagag
aacgggctgagtgagaagcctcacctcttggtgttccctcccgacttggtggcagagcag
tttacactgatggatgcggagctgttcaagaaggtggtgccctaccactgcctgggctcc
atctggtcccagcgggacaagaagggcaaggagcacctggcacccaccatccgcgccact
gtcacccaattcaacagcgtggccaactgcgtcatcaccacctgcctcggggaccgaagc
acaaaagccccagacagggccagggtggtggagcactggatcgaggtggccagggagtgc
cggatcctcaagaacttctcgtcgctgtatgccatcctctccgccctgcagagcaactcc
atccaccggctgaagaagacgtgggaagacgtttccagggacagtttccggatctttcag
aagctgtcggagatcttctcagatgagaacaactactcattgagccgggagctgctcatc
aaggaggggacctccaagtttgccacgctggagatgaaccccaagagagcccagaaacgg
ccaaaggagacgggcatcatccagggcaccgttccctacctgggcacgttcctcaccgac
ctggtgatgctggacaccgccatgaaggactatctgtatggcagactcatcaacttcgag
aagaggaggaaggagttcgaggtgatcgcccagatcaagctgctgcagtcggcctgcaac
aactacagcatcacaccagatgagcagtttggggtctggttccgggccttggaacggctc
agtgagactgagagctacaacctgtcgtgcgagctggagcccccatccgagtcagccagc
aacaccctcaggaccaagaagaacacagccattgtcaagcgctggagcgaccgccaggcc
cccagcactgagctcagtaccagcggcagctcccactccaagtcctgtgaccagctcagg
tgtggcccctacctcagcagcggggacattgctgacgcgctcagcgtgcactcggccggc
tcctccagctctgatgtggaggagatcaacatcagcttcgtcccggagtccccagatggc
caggaaaagaagttctgggaatcagcctcacagtcatccccggagacctccggcatcagc
tcggcctccagcagcacctcgtcctcctcagcctccaccacacccgtggctgccacacgc
acccacaagcgctccgtctcagggctctgcaactccagctccgcgctgccgctctacaac
cagcaggtgggcgactgctgcatcatccgcgtcagcctggacgtggacaacggcaacatg
tacaagagcatcctggtgaccagccaagataaggctccggccgtaatccgcaaggccatg
gacaaacacaacctggaggaggatgagccggaggactatgagctgctgcagattctctcc
gatgaccggaagctgaagatccctgaaaacgccaacgtcttctatgccatgaactctacc
gccaactatgactttgtcctgaagaagcgggccttcaccaagggagtgaaggtcaagcat
ggagccagctcaaccctccctcgcatgaagcagaaaggactcaagattgccaagggcatc
ttctga

DBGET integrated database retrieval system