KEGG   Macaca mulatta (rhesus monkey): 100426598
Entry
100426598         CDS       T01028                                 

Gene name
ADRB1
Definition
(RefSeq) beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04540  Gap junction
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04970  Salivary secretion
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100426598 (ADRB1)
   04024 cAMP signaling pathway
    100426598 (ADRB1)
   04022 cGMP-PKG signaling pathway
    100426598 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100426598 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100426598 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100426598 (ADRB1)
   04924 Renin secretion
    100426598 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100426598 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    100426598 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100426598 (ADRB1)
G protein-coupled receptors [BR:mcc04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100426598 (ADRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Other DBs
NCBI-GeneID: 100426598
NCBI-ProteinID: NP_001276795
Ensembl: ENSMMUG00000044756
UniProt: P47899
LinkDB
Position
9
AA seq 480 aa
MGAGALVLGASEPGNLSSAAPLPDGVATAARLLVPASPPASLLPPASEGPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPSPSPVPAPPPGPPRPAAAAAT
TAPLVNGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDR
LFVFFNWLGYANSAFNPIIYCRSPDFRNAFQRLLCCARRAARRRHAAHGDRPRASGCLAR
PGPPPSPGAASDDDDDDVVGATQPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgtggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgcctcccgccagcgaaggccccgagccgctgtcgcagcagtggacggcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaacgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggtg
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcggtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcatcgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcagccctggtgtccttcctgcccatcctcatgcattggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgatttcgtcacc
aaccgggcctacgccatcgcctcgtccgtggtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggccccgcgcggccgccctcgccctcgccctcgccctcg
ccctcgccggtccccgcgccgccgcccggacctccgcgccccgccgccgccgctgccacc
accgccccgctggtcaacggacgtgcgggtaagcggcggccctcgcgcctcgtggccctg
cgcgagcagaaggcgctcaagacgctgggcatcatcatgggcgtgttcacgctctgttgg
ctgcccttcttcctggccaacgtggtgaaggccttccaccgcgagctggtgcccgaccgc
ctcttcgtcttcttcaactggctgggctacgccaactcggccttcaaccccatcatctac
tgccgcagccccgacttccgcaacgccttccagcgactgctctgctgcgcgcgcagggct
gcccgccggcgccacgcggcccacggagaccggccgcgcgcctcgggctgtctggcccgg
cccggacccccgccgtcgcccggggccgcctcggacgacgacgacgacgatgtcgtcggg
gccacgcagcccgcgcgcctgctggagccctgggccggctgcaacggcggggcggcggcg
gacagcgactcgagcctggacgagccgtgccgccccggattcgcctcggagtccaaggtg
tag

DBGET integrated database retrieval system