KEGG   Macaca mulatta (rhesus monkey): 100426724
Entry
100426724         CDS       T01028                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X2
  KO
K04726  BH3 interacting domain death agonist
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01524  Platinum drug resistance
mcc04071  Sphingolipid signaling pathway
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04217  Necroptosis
mcc04650  Natural killer cell mediated cytotoxicity
mcc04932  Non-alcoholic fatty liver disease
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05152  Tuberculosis
mcc05160  Hepatitis C
mcc05161  Hepatitis B
mcc05162  Measles
mcc05163  Human cytomegalovirus infection
mcc05164  Influenza A
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05169  Epstein-Barr virus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05200  Pathways in cancer
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100426724 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100426724 (BID)
   04215 Apoptosis - multiple species
    100426724 (BID)
   04217 Necroptosis
    100426724 (BID)
   04115 p53 signaling pathway
    100426724 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100426724 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100426724 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100426724 (BID)
   05014 Amyotrophic lateral sclerosis
    100426724 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    100426724 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100426724 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100426724 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100426724 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100426724 (BID)
   05161 Hepatitis B
    100426724 (BID)
   05160 Hepatitis C
    100426724 (BID)
   05164 Influenza A
    100426724 (BID)
   05162 Measles
    100426724 (BID)
   05168 Herpes simplex virus 1 infection
    100426724 (BID)
   05163 Human cytomegalovirus infection
    100426724 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100426724 (BID)
   05169 Epstein-Barr virus infection
    100426724 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100426724 (BID)
SSDB
Motif
Pfam: BID Bcl-2 Rubis-subs-bind DUF4145 CRM1_C
Other DBs
NCBI-GeneID: 100426724
NCBI-ProteinID: XP_015005161
Ensembl: ENSMMUG00000020799
LinkDB
Position
10
AA seq 195 aa
MDCEVSNGSGLRDECVTNLLVFGFLQSCSDNSFRRELDALGRELPVPAAQWEAYDELQTD
GNRSSHSRMGRIEADSESQEDVIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPTDMEKEKTMLVLALLLAKKVASHTPSLLRDVFQTTVNFINQ
NLRAYVRSLARNGMD
NT seq 588 nt   +upstreamnt  +downstreamnt
atggactgtgaggtcagcaatggttccggcctcagggatgagtgcgtcacaaacctgctg
gtgttcggcttcctccaaagctgctctgacaacagcttccgcagagagctggacgcgctg
ggccgcgagctgccagtgccagctgcccagtgggaggcctacgacgagcttcagacggac
ggtaaccgcagcagccactcccgcatgggaagaatagaggcagattctgaaagtcaagaa
gacgtcatccggaacattgccaggcacctcgcccaggtcggggacagcatggaccgtagc
atccctccgggcctggtgaacggcctggccctgcagctccggaacaccagccggtcggag
gaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctaca
gacatggagaaggagaagacaatgctggtgctggccctgctgctggccaagaaggtggcc
agtcacacgccgtccttgctgcgtgatgtctttcaaacaacggtgaattttattaaccag
aacctacgcgcctatgtgaggagcttagccagaaacgggatggactga

DBGET integrated database retrieval system