KEGG   Macaca mulatta (rhesus monkey): 100428484
Entry
100428484         CDS       T01028                                 

Gene name
ITGA10
Definition
(RefSeq) integrin alpha-10 isoform X3
  KO
K06586  integrin alpha 10
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100428484 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100428484 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100428484 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100428484 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100428484 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100428484 (ITGA10)
   05414 Dilated cardiomyopathy
    100428484 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100428484 (ITGA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcc04515]
    100428484 (ITGA10)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   100428484 (ITGA10)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 100428484
NCBI-ProteinID: XP_015005654
Ensembl: ENSMMUG00000016043
LinkDB
Position
1
AA seq 1230 aa
MAQSFPWSGAPHSSPPSLLPFLPTLFLAAIGRGQDGRESKENRKGEGQTEARGLLIPDRN
GSGMELPLITHLFLPLVFLTGLCSPFNLDEHHPRLFPGPPEAEFGYSVLQHIGGGQRWML
VGAPWDGPSGDRRGDVYRCPVGGAHHAPCAKSHLGDYQLGNSSHPAVNMHLGMSLLETDG
DGGFMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNS
IYPWSEVQTFLRRLVGKLFIDPEQIQVGLVQYGESPVHEWSLGDFRTKEEVVRAAKNLSR
REGRETKTAQAIMVACTEGFSQSHGGRPEAARLLVVVTDGESHDGEELPAALKTCEAGRV
TRYGIAVLGHYLRRQRDPSSFLREIRTIASDPDERFFFNVTDEAALTDIVDALGDRIFGL
EGSHAENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEGGHHLFPPRMALE
DEFPSALQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSL
QGEQIGSYFGSELCPLDTDRDGTTDVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQG
TLQPEPPQDARFGFAMGALPDLNQDGFADVAVGAPLEDGHQGALYLYHGTQSGVRPHPAQ
RIAAASMPHALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAILLSSRPIVHLAPSLEVTPQ
AISVVQRDCRRRGQEAVCLTAALCFQVTSRTPGRWDRRFYMRFTASLDEWTAGARAAFDG
SGQRLSPRRLRLSVGNITCEQLHFHVLDTSDYLRPVAFTVTFALDNTTKPGPVLDEGSPT
SIQKLVPFSKDCGPDNECVTDLVLQVNMDIRGSRKAPFVVRGGRRKALVSATLENRKENA
YNTSLSLIFSRNLHLASLTPQRDSPIKVECAAPSTHARLCIVGHPVFQTGAKVTFLLEFE
FSCSSLLSQVFVKLTASSDSLERDGTLQDNTAQTSAHIQYEPHLLFSSESTLHRYEVHPY
GTLPVGPGPEFKTTLRVQNLGCYVVSGLIISALLPAVAHGGNYFLSLSQVITNNASCTVQ
NLTEPPAPPVHPEELQHTNRLNGSNTQCQVVRCHLGQLAKGTEVSVGLLRLVHNEFFRRA
KFKSLMVVSTFELGTEEGSVLQLTEASRWSESLLEVVQTRPILISLWILIGSVLGGLLLL
ALLVFCLWKLGFFTHKKIPEEEKREEKLEQ
NT seq 3693 nt   +upstreamnt  +downstreamnt
atggctcagtcctttccttggtctggggctccccacagttccccaccgtcactcctccca
ttccttccaactttatttttagctgccattgggagggggcaggatgggagggaaagtaaa
gaaaacagaaaaggagagggacagacagaggccagaggacttctcataccggacagaaac
ggatcaggcatggaactccccctcatcactcacctgttcttgcccctggtgttcctgaca
ggtctctgctccccctttaacttggatgaacatcacccacgcctattcccagggccacca
gaagctgaatttggatacagtgtcttacaacatattgggggtggacagcgatggatgctg
gtgggcgccccctgggatgggccttcaggtgaccggaggggggacgtttatcgctgccct
gtagggggggcccaccatgccccatgtgccaagagccacttaggtgactaccaactggga
aattcatctcatcctgctgtgaatatgcacctggggatgtctctgttagagacagatggt
gatgggggattcatggcctgtgcccctctctggtctcgtgcttgtggcagctctgtcttc
agttctgggatatgtgcccgtgtggatgcttcattccggcctcagggaagcctggcaccc
actgcccaacgctgcccaacatacatggatgttgtcatcgtcttggatggctccaacagc
atctacccctggtctgaagttcagaccttcctacgaagactggtagggaaactgtttatt
gacccggaacagatacaggtgggactggtacagtatggggagagccctgtacatgagtgg
tccctgggagattttcgaacgaaggaagaagtggtgagagcagcaaagaacctcagtcgg
cgggagggacgagaaacaaagactgcccaagcaataatggtggcctgcacagaagggttc
agtcagtcccatgggggccgacccgaggctgccaggctactggtggttgtcactgatgga
gagtcccatgatggagaggagcttcctgcagcactaaagacctgtgaggctggaagagtg
acacgctatgggattgcagtccttggtcactacctccggcggcagcgagatcccagctct
ttcctgagagaaattagaactattgccagtgatccagatgagcgattcttcttcaatgtc
acagatgaggctgctctgactgacattgtggatgcactaggagatcggatttttggcctc
gaaggttcccatgcagaaaatgaaagctcctttgggctggaaatgtctcagattggtttc
tccactcatcggctaaaggatgggattctctttgggatggtgggggcctatgactggggg
ggctctgtgctatggcttgaaggaggtcaccaccttttccccccacgaatggctctggaa
gacgagttcccctctgcattgcagaaccatgcagcctacctgggttactctgtttcttcc
atgcttttgcggggtggacgccgcctgtttctctctggggctcctcgatttagacatcga
ggaaaagtcatcgccttccagcttaagaaagatggggctgtgagggttgcccagagcctc
cagggggagcagattggttcatactttggcagtgagctctgcccattggatacagatagg
gatggaacaactgatgtcttacttgtggctgcccccatgttcctgggaccccagaacaag
gaaacaggacgtgtttatgtgtatctggtgggccagcagtccttgctgaccctccaagga
acacttcagccagaacccccccaggatgctcgatttggctttgccatgggtgctcttcct
gatctgaaccaagatggttttgctgatgtggctgtgggggcacctctggaggatgggcac
cagggagcactgtacctgtaccatggaacccagagtggagtcaggccccatcctgcccag
aggattgctgctgcctccatgccacatgccctcagctactttggccgaagtgtggatggc
cggctagatctggatggagatgatctggtcgatgtggctgtgggtgcccagggggcggcc
atcctgctcagctcccggcccattgtccatctggccccgtcactggaggtgaccccacag
gccatcagtgtggttcagagggactgtaggcggcgaggccaggaggcagtctgtctgact
gcagccctctgcttccaagtgacctcccgtactcctggtcgctgggatcgccgattctac
atgaggttcacagcatcactggatgaatggacggctggggcacgtgcagcatttgatggc
tctggccagaggctgtcccctcggaggctccggctcagtgtggggaatatcacttgtgag
cagctacacttccatgtgctggatacgtcagattacctccggcctgtggcctttactgtg
acctttgccttggacaataccacaaagccagggcctgtgctggatgagggctcacccacc
tctatacaaaagctggtccccttctcaaaggattgtggccctgacaatgaatgtgtcaca
gacctggtgcttcaagtgaatatggacatcagaggctccaggaaggccccatttgtggtt
cgaggtggccggcggaaagcgctggtatctgcaactctggaaaacaggaaggaaaatgct
tacaatactagcctgagtctcatcttctctagaaacctccacctggccagtctcactcct
cagagagacagcccaataaaggtggaatgtgcagccccttctactcatgccaggctctgc
attgtggggcatcctgtcttccagactggagccaaggtgacctttctgcttgagttcgag
tttagctgctcctctctcctgagccaagtcttcgtgaagctgactgccagcagtgacagc
ctggagagagatggaacccttcaagataacacagcccagacctcagcccatatccaatat
gagccccatctcctcttctctagtgagtctaccctgcaccgctatgaggttcacccatat
gggaccctcccagtgggtcctggcccagaattcaaaaccactcttagggttcagaaccta
ggctgctatgtggtcagtggcctcatcatctcagccctccttccagctgtagcccatggg
ggcaattacttcctatcactgtctcaagtcatcactaacaatgcaagctgcacagtgcag
aatctgactgaacccccagcaccccctgtgcatccagaggagcttcaacacacaaacaga
ctgaatgggagcaatactcagtgtcaggtggtgaggtgccaccttgggcagctggcaaag
gggaccgaggtctctgttggactattgaggctggttcacaatgaatttttccgaagagcc
aagttcaagtccctgatggtggtcagcacctttgagctgggaaccgaggagggcagtgtc
ctacagctgactgaagcctcccgttggagtgagagccttctggaggtggttcagacccgg
cctatcctcatctccctgtggatcctcataggcagtgtcctgggagggttgctcctgctt
gctctccttgtcttctgcctgtggaagcttggcttctttacccataagaaaatccctgag
gaagaaaaaagagaagagaagttggaacaatga

KEGG   Macaca mulatta (rhesus monkey): 106992270
Entry
106992270         CDS       T01028                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106992270 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    106992270 (ITGA9)
   04514 Cell adhesion molecules
    106992270 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106992270 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106992270 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106992270 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106992270 (ITGA9)
   05414 Dilated cardiomyopathy
    106992270 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    106992270 (ITGA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcc04515]
    106992270 (ITGA9)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   106992270 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 106992270
NCBI-ProteinID: XP_014986852
UniProt: F6T4B4
LinkDB
Position
2
AA seq 1035 aa
MGGPAAPRGAGGLRALLLALVVAGIPAGAYNLDPQRPVHFQGPADSFFGYAVLEHFHDNT
RWVLVGAPKADSKYSPSVKSPGAVFKCRVHTNPDRRCTELDMARGKNRGTSCGKTCREDR
DDEWMGVSLARQPKADGRVLACAHRWKNIYYEADHILPHGFCYIIPSNLQAKGRTLIPCY
EEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTVKVLNLTDNMYLKLNDEVIM
NRRYTYLGYAVTAGHFSHASTTDVVGGAPQDKGIGKVYIFRADRRSGTLIKIFQASGKKM
GSYFGSSLCAVDLNGDGLSDLLVGAPMFSEIRDEGQVTVYINRGNGALEEQLALTGDGAY
NAHFGESIASLDDLDDDGFPDVAIGAPKEDDFAGAVYIYHGDASGIVPQYSMKLSGRKIN
PVLRMFGQSISGGIDMDGNGYPDVTVGAFMSDSVVLLRARPVITMDVAIFLPGSINITAP
QCHDGQQPVNCLNVTTCFSFRGKHVPGEIGLNYVLTADVAKKEKGQLPRVYFVLLGETVG
QVTEKLQLTYMEETCRHYVAHVKRRVQDVISPIVFEAAYSLGEHVTGEEERELPPLTPVL
RWKKGQKIAQKNQTVFERNCHSEDCAADLQLRGKLLLSGMDEKTLYLALGAVKNISLNIS
ISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLESDFLKCSVGFPFMRSKSKYE
FSVIFDTSHLSGEEEVLSFIVTAQSGNMERSESLHDNTLVLMVPLMHEVDTSITGIMSPT
SFVYGESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEM
FHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGRKVLDCEKPGISCLT
AHCNFSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMSRAKVKVDPALRVVEIAHGNPE
EVTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLLWKMGFFRRRYKEIIEAEKN
RKENEDSWDWVQKNQ
NT seq 3108 nt   +upstreamnt  +downstreamnt
atgggcggcccggctgcgccgaggggcgccggggggctccgcgcgctgctgctggcgctg
gtggtcgcggggatccccgcgggcgcctacaacctcgacccgcagcgtccggtgcacttc
cagggccccgccgactcgttcttcggctacgcggttctggagcatttccacgacaacacg
cgctgggtccttgtgggtgcaccaaaggcagattccaaatacagcccttcagtgaagtct
cctggggctgtgtttaagtgccgtgttcacaccaaccctgaccggagatgcactgaactg
gacatggctcgagggaagaatcggggcacgtcctgcggaaagacctgccgggaagaccgc
gatgatgagtggatgggggtgagcctggcccggcagccgaaggctgatggccgcgtgttg
gcctgtgctcatcgctggaagaacatctactatgaagctgaccacatcctaccccatggc
ttctgctacatcatcccttccaatctccaggccaaaggcaggacgctgatcccttgctat
gaagagtataagaagaagtacggagaggaacacggctcctgccaggctgggatagcgggc
ttcttcaccgaggagctggtggtgatgggtgccccagggtcattttactgggctggaacc
gtcaaagtgctgaaccttactgacaacatgtacttaaaactgaacgatgaagtgatcatg
aacaggcggtacacctacctgggctacgcagtgaccgctggccacttctctcacgcatcc
accactgatgtggtaggaggtgccccacaggacaaaggcatcggcaaggtttatattttc
agagctgaccgaagatcaggcaccttaattaagatctttcaagcatcaggtaaaaagatg
ggctcttacttcggctcctccttgtgcgcagttgacctgaatggggacggcctctctgac
ctgctggtgggggcccccatgttttctgagatcagggacgagggacaggtcactgtctac
atcaacagaggaaatggagccctcgaggagcagctggctctgactggggatggcgcctac
aacgcgcactttggagaaagcattgccagcctggacgatctggatgacgatgggttccca
gatgtggccattggtgcacccaaggaggacgacttcgcaggggcggtctatatctatcac
ggtgatgccagtgggatagtcccgcagtactcaatgaaactgtctgggcggaagataaat
ccagtgctccggatgtttggtcagtccatatcgggaggcattgatatggatggaaatggc
tatcctgatgtcactgttggagccttcatgtccgacagcgtggttctcctcagagcaagg
cctgtcattacgatggatgtcgccatcttcctcccgggctccatcaacatcacggcgcct
cagtgtcacgacggacagcagcctgtgaactgcctgaatgtcaccacctgcttcagcttc
cgtggcaaacacgttccaggagagattggactgaattatgttctgacggctgacgtggcc
aaaaaggagaagggccagctgcccagggtctactttgtgcttctgggagagacggtgggt
caggtcacagagaagctgcagctgacttacatggaggagacgtgtcgtcactacgtggcc
catgtgaagcggagggtgcaggacgtcatcagcccaatcgtgtttgaagcagcctacagc
ctcggtgagcacgtgactggagaggaggagagggaactgccgcctctgacaccagttctc
cgctggaaaaagggacaaaagattgcccaaaagaatcagactgtttttgaaaggaattgc
cattcagaggactgtgccgcggacctgcagcttcggggtaaactgctgctctctggtatg
gatgagaaaaccctgtatctcgctttgggggctgtgaagaacatctccctaaacatctct
atctccaacctcggagatgatgcctatgacgccaacgtgtccttcaatgtttcccgggag
ctcttcttcatcaacatgtggcagaaggaggagatgggcatctcctgtgagctgctggaa
tcggacttcctcaaatgcagcgtgggatttcctttcatgaggtcgaagtcaaagtatgaa
ttcagtgtgatctttgatacaagccacctgtctggggaagaggaagttctcagcttcatt
gttactgctcagagtggcaacatggaacgctctgaatccctgcatgacaacaccctcgtg
ctgatggtgccgctgatgcacgaggtggacacatccatcaccggaatcatgtctccaacc
tcctttgtgtatggtgagtccgtggatgcagccaacttcattcagctggatgacctggag
tgtcactttcagcccatcaatatcacccttcaggtctacaacactggcccgagcaccctt
ccagggtcatctgtcagcatctctttccctaatcgactctcatctggtggtgcagagatg
tttcatgtccaggaaatggtggtgggccaagagaaaggaaactgctctttccagaaaaac
ccaactccctgcatcatccctcaagaacaagaaaatatcttccacacaatatttgctttt
ttcacaaagtctggaagaaaagtcttggactgtgaaaaaccaggaatttcttgcctaaca
gcacactgtaactttagtgctcttgctaaagaagaaagtcgtactatagacatttacatg
ctgctgaacacagaaatactgaaaaaggacagttcatctgtcatccagttcatgtcccgc
gccaaggtgaaggtggatcctgccctaagggtggtggaaatagctcatggcaacccagaa
gaggtgacggtggtcttcgaggccctgcacaatctggagccccgtggctacgtcgtgggc
tggatcatcgccatcagtttgttggtgggaatcctcatcttcctgctgctggctgtgttg
ctctggaagatgggcttctttcgccgaaggtacaaagaaattatcgaagctgagaagaac
cggaaagagaatgaagacagttgggactgggtccagaaaaaccagtga

KEGG   Macaca mulatta (rhesus monkey): 574315
Entry
574315            CDS       T01028                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc05100  Bacterial invasion of epithelial cells
mcc05133  Pertussis
mcc05135  Yersinia infection
mcc05165  Human papillomavirus infection
mcc05168  Herpes simplex virus 1 infection
mcc05205  Proteoglycans in cancer
mcc05206  MicroRNAs in cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    574315 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    574315 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    574315 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    574315 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    574315 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    574315 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    574315 (ITGA5)
   05205 Proteoglycans in cancer
    574315 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    574315 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    574315 (ITGA5)
   05414 Dilated cardiomyopathy
    574315 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    574315 (ITGA5)
   05133 Pertussis
    574315 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    574315 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    574315 (ITGA5)
   05165 Human papillomavirus infection
    574315 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    574315 (ITGA5)
   04515 Cell adhesion molecules [BR:mcc04515]
    574315 (ITGA5)
   04090 CD molecules [BR:mcc04090]
    574315 (ITGA5)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   574315 (ITGA5)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   574315 (ITGA5)
CD molecules [BR:mcc04090]
 Proteins
  574315 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 574315
NCBI-ProteinID: XP_015007379
Ensembl: ENSMMUG00000003755
LinkDB
Position
11
AA seq 1098 aa
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTPESPLH
AVQLRWGPRRRSPLLPLLLLLLPPPPRVGGFNFDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGTSPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTNNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVAATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYVYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQILQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALDFS
LDPQAPVDSHGLRPALHYQSKSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDVGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVTGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKC
PEAECLRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PRQLPQKERQVATAVQWTKAEGSYGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgccagagtcccctctccac
gccgtgcagctgcgctggggcccccggcgccgatccccgctgctgccgctgctgctactg
ctgctgccgccgccacccagggtcgggggcttcaactttgacgcggaggccccagcagtg
ctctcggggcccccaggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctagtgggagcacccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggcaccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcgtgcgctccactgtacagctggcgcacagagaaggagccactgagcgac
cccgtgggtacctgctacctctccacaaataacttcacccgaattctggagtatgcacct
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagtgct
gagttcaccaagactggccgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttactaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgtaggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatc
cgatccctctacaacttctcaggggaacagatggcctcctacttcggctatgcagtggct
gccacagacatcaatggggacgggctggatgacttgctggtaggggcacccctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacgtctacctgcagcac
ccagccggcatagagcccacacccacccttaccctcactggccatgatgagtttggccga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
attggggctccctttggtggggagacccagcagggagtagtgtttgtattccctgggggc
ccaggagggctgggctctaagccttcccagattctgcaacccctgtgggcagccagccac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaacggatac
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacaggggccgcccc
atcgtgtctgccagtgcctccctcaccatcttccctgccatgttcaacccagaggagcgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacatgttgctgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaatgagtcagaatttcgagacaaactctccccaattcacatcgctctcgacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctgcattaccagagc
aagagccggatagaggacaaggctcaaatcttgctggactgtggagaggacaacatctgc
gtgcctgacctgcagctggaagtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctaaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtcaccgcccctccagaggctgagtactcaggactcgtcagacatccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagtgacgtggtttccttccggctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctccaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacgtgggacctgctgtgcaccatgtctatgag
ctcatcaaccaaggccccagctccatcagccagggcgtgctggagctcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttacgggactcaactgcaccacc
aatcaccccattaacccaaaaggcctggagttggatcccgagggttccctgcaccaccgg
caaaaacgggaagctccaagccgcagctctgcttcctctggacctcagatcctgaaatgc
ccggaggctgagtgtttgaggctgcgctgtgagctcgggcccctgcaccaacaagagagc
caaagtctgcagctgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcggcagctgccccaaaaggagcgtcaggtggccacagctgtgcaatggaccaaggca
gaaggcagctatggcgtcccactgtggatcatcatcctagccatcctttttggcctcctg
ctcctaggtctactcatctacatcctctacaagctcggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

KEGG   Macaca mulatta (rhesus monkey): 694090
Entry
694090            CDS       T01028                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11
  KO
K06587  integrin alpha 11
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    694090 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    694090 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    694090 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    694090 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    694090 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    694090 (ITGA11)
   05414 Dilated cardiomyopathy
    694090 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    694090 (ITGA11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcc04515]
    694090 (ITGA11)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   694090 (ITGA11)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N Mur_ligase_C
Other DBs
NCBI-GeneID: 694090
NCBI-ProteinID: XP_014998040
Ensembl: ENSMMUG00000004026
LinkDB
Position
7
AA seq 1188 aa
MDLPRGLVVAWALSLWPGFTDTFNMDTRKPRVIPGSRTAFFGYTVQQHDISGKKWLVVGA
PLETNGHQKTGDVYKCPVIHGNCTKLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLA
CSPLWSHECGSSYYTTGMCSRVNSNFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVE
VQHFLINILKKFYIGPGQIQVGVVQYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTET
RTAFGIEFARSEAFQKGGRKGAKKVMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVL
GYYNRRGINPETFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNET
SFGLEMSQTGFSSHVVEDGVLLGAVGAYDWNGAVLKETSAGKVIPLRESYLKEFPEELKN
HGAYLGYTVTSVVSSRQGRVYVAGAPRFNHTGKVILFTMHNNRSLTIHQALRGQQIGSYF
GSEITSVDIDGDGVTDVLLVGAPMYFSEGRERGKVYVYELRQNRFVYNGTLKDSHSYQNA
RFGSSIASVRDLNQDSYDDVVVGAPLEDNHAGAIYIFHGFRGSILKTPKQRITASELATG
LQYFGCSIHGQLDLNEDGLIDLAVGALGNAVILWSRPVVQINASLHFEPSKINIFHRDCK
RSGRDATCLAAFLCFTPVFLAPHFQTTTVGIRYNATMDERRYTPRAHLDEGGDRFTNRAV
LLSSGQELCERINFHVLDTADYVKPVTFSAEYSLEDPDHGPMLDDGWPTTLRVSVPFWNG
CNEDEHCVPDLVLDARSDLPTAMEYCQRVLRKPTQDCSAYTLSFDTTVFIIESTRRRVAV
EATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGNIECVNEERRLQKKVCNVSYPFF
RAKAKVAFRLDFEFSKSIFLHHLEIELAAGSDSNERDSTKEDNVAPLRFHLKYEADVLFT
RRSSLSHYEVKPNSSLERYDGIGPPFSCIFRIQNLGLFPIHGVMMKITVPIATRGGNRLL
KLRDFLTHQANTSCNIWGNSTEYRPTPVEEDLSRAPQLNHSNSDVVSINCNIRLAPNQEI
NFHLLGNLWLRSLKALKYKSMKIMVNAALQRQFHSPFIFREEDPSRQIVFEISKQEDWQV
PIWIIVGSTLGGLLLLALLVLALWKLGFFKSARRRREPGLDPTPKVLE
NT seq 3567 nt   +upstreamnt  +downstreamnt
atggacctgcccaggggcctggtggtggcctgggccctcagcctgtggccagggttcacg
gacaccttcaacatggacaccaggaagccccgggtcatccctggctccaggaccgccttc
tttggctacacagtgcagcagcatgacatcagtggcaagaagtggctggtcgtgggcgcc
ccactggaaaccaatggccaccagaagacgggagacgtgtacaagtgtccagtgatccac
gggaactgcaccaaactcaacctgggaagggtcaccctgtccaacgtgtccgagcggaag
gacaacatgcgcctcggccttagtctcgccaccaaccccaaggacaacagcttcctggcc
tgcagccccctctggtctcacgagtgtgggagctcctactacaccacagggatgtgttca
agagtcaactccaacttcaggttctccaagaccgtggccccagctctccaaaggtgccag
acctacatggacatcgtcattgtcctggatggctccaacagcatctacccctgggtggag
gttcagcacttcctcatcaacatcctgaagaagttttacatcggcccagggcagatccag
gttggagttgtgcagtatggagaagatgtggtgcatgagtttcacctcaatgactacagg
tctgtaaaagatgtggtggaagctgccagccacattgagcagagaggaggaacagagacc
cggacagcatttggcatcgaatttgcacgctcagaggctttccagaagggcggaaggaaa
ggggccaagaaagtgatgattgtcatcacagatggagagtcccacgacagcccagacctg
gagaaggtgatccagcaaagcgagagagacaatgtaacaagatatgcggtggccgtcctg
ggctactacaaccgcaggggcatcaatccagaaacttttctaaatgaaatcaaatacatc
gccagtgaccccgatgacaagcacttcttcaatgtcactgatgaggctgccttgaaggac
attgtcgatgccctgggggacagaatcttcagcctggaaggcaccaacaagaacgagacc
tcctttgggctggagatgtcacagacaggcttttcctcgcacgtggtggaggatggggtt
ctgctgggagctgttggtgcctatgactggaacggagctgtgctaaaggagacgagtgcc
ggcaaggtcattcctctccgtgagtcctacctgaaagagttccccgaggagctcaagaac
catggcgcatacctggggtacacagtcacatcggtcgtgtcctccaggcaggggcgggtg
tacgtggccggagccccccggttcaaccacacgggcaaagtcatcctgttcaccatgcac
aacaaccggagcctcaccatccaccaggctctgcggggccagcagataggctcttacttt
gggagtgagatcacctcggtggacattgacggagatggtgtcactgatgtcctgctggtg
ggtgcacccatgtacttcagcgagggccgcgagcgaggcaaagtgtacgtctacgagctg
agacagaatcggtttgtttataacggaacgctcaaggattcacacagttaccagaatgcc
cggtttgggtcctccattgcctcagttcgagacctcaaccaggattcctacgacgatgtg
gtggtgggagcgcccctggaggacaaccacgcaggagccatctacatcttccacggcttc
cgaggcagcatcctgaagacgcctaagcagagaatcacagcctcagagctggctaccggc
ctccagtattttggctgcagcatccacgggcaattggacctcaatgaggatgggcttatc
gacctggcagtgggagcccttggcaacgctgtgattctctggtcccgccctgtggttcag
atcaatgccagcctccactttgagccatccaagatcaacatcttccacagagactgcaag
cgcagtggcagggatgccacctgcctggccgccttcctctgcttcacacccgtcttcctg
gcaccccacttccaaacgacaactgttggcatcagatacaatgccaccatggacgagagg
cggtatacaccgagggcccacctggatgagggcggggaccgattcaccaacagagctgtc
ctgctctcctccggccaggagctctgtgagaggatcaacttccatgtcctggacactgct
gactacgtgaagccagtgactttctcagccgagtattccctggaggaccctgaccatggc
cccatgctggacgacggctggcccaccaccctcagagtctcggtgcccttctggaacggc
tgcaatgaggatgagcactgtgtccctgaccttgtgctggatgcccggagtgacctgccc
acagccatggagtactgccagagggtgctgaggaagcctacacaggactgctccgcatac
acgctgtccttcgacaccacagttttcatcatagagagcacacgccggcgagtggcagtg
gaggccacactggagaacaggggcgagaacgcctacagcacagtcctaaatatctcacag
tcagcaaacctgcagtttgccagcttgatccagaaggaggactcggacggtaacatcgag
tgcgtgaacgaggagaggaggctccagaagaaagtctgcaatgtcagctaccccttcttc
agggccaaggccaaggtggctttccgtcttgattttgagttcagcaaatccatcttccta
caccacctggagatcgagctcgctgcaggcagtgacagtaacgagcgggacagcaccaag
gaagacaacgtggcccccctacgcttccacctcaaatacgaggccgacgtcctcttcacc
aggaggagcagcctgagccactacgaggtcaagcccaatagctcgctggagagatacgat
ggtatcgggcctcccttcagctgcatcttcaggatccagaacctgggcttgttccccatc
cacggggtgatgatgaagatcaccgttcccatcgccaccaggggcggcaaccgcctgctg
aagctgagggacttcctcacccaccaggcgaatacgtcctgtaacatctgggggaacagc
actgagtaccggcccaccccagtggaggaagacttgagtcgtgctccgcagctgaatcac
agcaactctgatgtcgtttccatcaattgcaatatacggctggcccccaaccaggaaatc
aatttccatctactggggaacctgtggttgaggtccctaaaagcactcaagtacaaatcc
atgaaaatcatggtcaacgcagccttgcagaggcagttccacagccccttcatcttccgt
gaggaggatcccagccgccagatcgtgtttgagatctccaagcaagaggactggcaggtc
cccatctggatcattgtgggcagcaccctggggggcctcctgctgctggccctgctggtc
ctggcactgtggaagctcggcttctttaaaagtgccaggcgcaggagggagcctggtctg
gaccccacccccaaagtgctggagtga

KEGG   Macaca mulatta (rhesus monkey): 697643
Entry
697643            CDS       T01028                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 precursor
  KO
K06485  integrin alpha 6
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc05145  Toxoplasmosis
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    697643 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    697643 (ITGA6)
   04514 Cell adhesion molecules
    697643 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    697643 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    697643 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    697643 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    697643 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    697643 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    697643 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    697643 (ITGA6)
   05414 Dilated cardiomyopathy
    697643 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    697643 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    697643 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    697643 (ITGA6)
   04515 Cell adhesion molecules [BR:mcc04515]
    697643 (ITGA6)
   04090 CD molecules [BR:mcc04090]
    697643 (ITGA6)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   697643 (ITGA6)
  Exosomal proteins of breast milk
   697643 (ITGA6)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   697643 (ITGA6)
CD molecules [BR:mcc04090]
 Proteins
  697643 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM Integrin_alpha
Other DBs
NCBI-GeneID: 697643
NCBI-ProteinID: NP_001245046
Ensembl: ENSMMUG00000002370
UniProt: F7BZD3
LinkDB
Position
12
AA seq 1091 aa
MAAAGQLCLLYLSAGLLPRLGSAFNLDAEEDNVIRKYGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIYEDGPYEVG
GETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLRRDMKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYMNQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDMGKVFIYHGSANGINTK
PTQVLKGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNR
IDLRQKTACGAPSGICLQVKACFEYTAKPAGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLKRQKQKVCMEETLWLQDNIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSDEPKTAHTDVHFLKEGCGDDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLVLSTTEVTFDTPDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLEKITCEPQKEINFLNLKESHNSRK
KREITEKQIDDSRKFSLFAERKYQTLNCSVNVNCVNIRCPLRGLDSKASLILRSRLWNST
FLEEYSKLNYLDILVRAFIDVTAAAENIKLPNAGTQVRVTVFPSKTVAQYSGVPWWIILV
AVLAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYIDNLEKKQW
ITKWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggctgccgcggggcagctgtgcctgctctacctgtcggccgggctcctgccccggctc
ggctcagccttcaacttggacgctgaggaggacaacgtgatccggaaatatggggacccc
gggagcctcttcggcttctcgctggccatgcactggcaactgcagcccgaggacaagcgg
ctgttgctcgtgggggccccgcgggcagaagcgcttccactgcagagagccaacagaact
ggagggctgtacagctgcgacatcaccgcccgggggccatgcacacgcatcgaatttgat
aacgatgctgaccccacgtcagaaagcaaggaagatcagtggatgggggtcaccgtccag
agccaaggtccggggggcaaggtcgtgacatgtgctcaccgatatgaaaaaaggcagcat
gttaatacgaagcaggaatcccgagacatctttgggcggtgttatgtcctgagccagaat
ctcaggattgaagacgatatggatgggggagattggagcttttgtgatgggcgattgaga
ggccatgagaaatttggctcttgccagcaaggtgtagcagctacttttactaaagacttt
cattacattgtatttggagccccgggtacttacaactggaaagggattgttcgtgtagag
caaaagaataacactttttttgacatgaacatctatgaagatgggccttatgaagttggt
ggagagactgagcatgatgaaagtctcgttcctgttcctgctaacagttacttaggtttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
cccagagccaatcacagtggagccgtggttttgctaaggagagatatgaagtctgcacat
ctcctccctgagcacatattcgatggagaaggtctggcctcttcatttggctatgatgtg
gcggtggtggacctcaacaaggatgggtggcaagatatagttattggagccccacagtat
tttgatagagatggagaagttggaggtgcagtgtatgtctacatgaaccagcaaggcaga
tggaataatgtgaagccaattcgtcttaatggaaccaaagattctatgtttggcattgca
gtaaaaaatattggagatattaatcaagatggctacccagatattgcagttggagctccg
tatgatgacatgggaaaggtttttatctatcatggatctgcaaatggaataaataccaaa
cctacacaggttctcaagggtaaatcaccttattttggatattcaattgctggaaacatg
gaccttgatcgaaattcctaccctgatgttgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaatattcagaaaaccatcacagtaactcctaataga
attgacctccgccagaaaacagcgtgtggggcgcctagcgggatatgcctccaggttaaa
gcctgttttgaatatactgctaaacccgctggttataatccttcaatatcaattgtgggc
acactcgaagctgaaaaagaaagaagaaaatctgggctatcctcaagagttcagtttcga
aaccaaggttctgagcccaaatatactcaagaactaactctgaaaaggcagaaacagaaa
gtgtgcatggaggaaaccctctggctacaggataatatcagagataaactgcgtcccatt
cccataactgcttcagtggagatccaagaaccaagctctcgtaggcgagttaattcactt
ccagaagttcttccaattctgaattcagatgaacccaagacagctcatactgatgtgcac
ttcttaaaagagggatgtggagacgacaatgtatgtaacagcaaccttaaactagaatac
aaattttgcacccgagaaggaaatcaagataaattttcttatttaccaattcaaaaaggt
gtaccagaactagttctaaaagatcagaaggatattgctttagaaataacagtgacaaac
agcccttccaacccaaggaatcccacaaaagatggcgatgacgcccatgaggctaaactg
attgcaacgtttccagacactttgacatattctgcatatagagaactgagggctttccct
gagaaacagttgagttgtgttgccaaccagaatggctcgcaagctgactgtgagcttgga
aatccttttaaaagaaattcaagtgttactttttatttggttttaagtacaactgaagtc
acctttgacaccccagatctggatattaatctgaagttagaaacaacaagcaatcaagat
aatttggctccaattacagctaaagcaaaagtggttattgaactgcttttatcggtctcg
ggagttgctaaaccttcccaggtgtattttggaggtacagttgttggcgagcaagctatg
aaatctgaagatgaagtgggaagtttaatagagtatgaattcagggtaattaacttaggt
aaacctcttaaaaacctcggcacagcaaccttgaacattcagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggaaaagataact
tgtgagccacaaaaggagataaacttcctgaacctcaaggagtctcacaactcaagaaag
aaacgggaaattactgaaaaacagatagatgatagcagaaaattttctttatttgctgaa
agaaaataccagactcttaactgtagcgtgaatgtgaactgtgtgaacatcagatgccca
ctgcgagggctggacagcaaggcgtctcttattttgcgctcgaggttatggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcgtgcgagccttcattgat
gtgactgctgctgccgaaaatatcaagctgccaaatgcaggcactcaggttcgtgtgact
gtgtttccctcaaagactgtagctcagtattcaggagtaccttggtggatcatcctagtg
gctgttctcgctgggattttgatgcttgctttgttagtgtttatactatggaagtgtgga
ttcttcaaacgctctaggtacgatgacagtgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaagtatattgataaccttgaaaaaaaacagtgg
atcacaaagtggaacgaaaatgaaagctactcatag

KEGG   Macaca mulatta (rhesus monkey): 698888
Entry
698888            CDS       T01028                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8 isoform X1
  KO
K06584  integrin alpha 8
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    698888 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    698888 (ITGA8)
   04514 Cell adhesion molecules
    698888 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    698888 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    698888 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    698888 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    698888 (ITGA8)
   05414 Dilated cardiomyopathy
    698888 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    698888 (ITGA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mcc04515]
    698888 (ITGA8)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   698888 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 698888
NCBI-ProteinID: XP_001089317
Ensembl: ENSMMUG00000011661
UniProt: A0A5F8AHQ3
LinkDB
Position
9
AA seq 1063 aa
MSPGASRGPWGSRTPLIAPLCCAAAALGMMMWSPASQAFNLDVEKLTVYSGPEGSYFGYA
VDFHIPDARTASVLVGAPKANTSQPDIVEGGAVYYCPWPAEGSAQCRQIPFDTTNNRKIR
VNGTKEHIEFKSNQWFGATVKAHKGKVVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSA
YAEFSPCRNSNADPEGQGYCQAGFSLDFYKNGDLIVGGPGSFYWQGQVITASVADIIANY
SFKDILRKLAGEKQTEVAPASYDDSYLGYSVAAGEFTGDSQQELVAGVPRGAQNFGYVSI
INSTDMTFIQNFTGEQMASYFGYTIVVSDVNSDGLDDVLVGAPLFMEREFESNPREVGQI
YLYLQVSSLLFRDPQILTGTETFGRFGSAMAHLGDLNQDGYNDIAIGVPFAGKDQRGKVL
IYNGNKDGLNTKPSQVLQGVWASHAVPSGFGFTLRGDSDIDKNDYPDLIVGAFGTGKVAV
YRARPVVTVDAQLLLHPMIVNLENKTCQIPDSVTFAACFSLRVCASVAGQSISNTIVLMA
EVQLDSLKQKGAIKRTLFLDNHQAHHVFPLVIKGQKSHQCRDFIVYLRDEIEFRDKLSPI
NISLNYSLDESTFKEGLEVKPILNYYRENVVSEQAHILVDCGEDNLCVPDLKLSARPDKH
QVIIGDENHLMLIINARNEGEGAYEAELFVMIPEEADYVGIERNNKGFRPLSCEYKMENV
TRMVVCDLGNPMVSGTNYSLGLRFAVPRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQIN
ITAVAQVEIRGVSHPPQIVLPIHNWEPEEEPHKEEEVGPLVEHIYELHNIGPSTISDTIL
EVGWPFSARDEFLLYIFHIQTLGPLQCQTNPNINPQDIKPAASPEHTPELSAFLRNSTIP
HLVRKRDVPVVEFHRQSPAKILNCTNIECLQISCAVGRLEGGESAVLKVRSRLWAHTFLQ
RKNDPYALASLVSFEVKKMPYKDQPAKLPEGSIAIKTSVIWATPNVSFSIPLWVIILAIL
LGLLVLAILTLALWKCGFFDRARPPQEDMTDKEQLTNDKTPEA
NT seq 3192 nt   +upstreamnt  +downstreamnt
atgtcgcccggggccagccgcggtccctggggaagccggacgccgctgatcgcgcctctc
tgctgcgctgcggccgcgctggggatgatgatgtggtctcctgcctcgcaggcgttcaac
ctggacgtggaaaagctcacggtgtacagcggccccgagggcagctacttcggttacgct
gtggacttccacatacccgacgcccgcacagcgagtgtcttggtgggggcccccaaagcc
aacaccagccagcccgacatcgtggaagggggagccgtctattactgtccttggcccgca
gaggggtctgcgcagtgcaggcagataccatttgacaccaccaacaacagaaagatcaga
gttaatggaaccaaagaacatattgagtttaaatccaatcagtggtttggagcaacagtg
aaagctcacaaaggaaaagttgtggcctgtgctcctttatatcactggagaactcttaaa
ccaacgccagaaaaggacccagttggcacctgctatgtagcaattcagaacttcagcgcc
tatgccgagttctctccttgccggaacagcaacgctgatccggaagggcagggttactgc
caagcaggatttagtctggatttttataagaatggagaccttattgtgggaggacctggg
agtttctactggcaagggcaagtgatcactgccagtgttgcagatatcattgcaaattac
tcattcaaggatatcctcagaaaactggcaggagaaaagcagacagaagtggctccagct
tcctatgatgacagttaccttggatactcagttgctgctggggagtttacgggggattct
cagcaagaattggttgctggagttccaagaggagcacagaattttggatatgtttcaatc
attaactctacagatatgacgtttattcagaatttcactggcgaacagatggcatcttat
tttggatataccattgtcgtatcagatgttaacagtgatggactggatgatgtcctggtt
ggggcacctctctttatggaacgtgaatttgagagcaaccccagagaagtagggcaaatc
tacctgtatttgcaagtgagctccctcctcttcagagacccccagatccttactggcact
gagacatttgggagattcggaagtgctatggcgcacttaggagacctgaaccaagatgga
tacaatgacattgccatcggcgtgccttttgcaggcaaggatcaacgaggcaaagtgctc
atttataatgggaacaaagatggcttaaacaccaagccttcccaagttctgcaaggagtg
tgggcctcacacgctgtcccttctggatttggctttactttaagaggagattcagacata
gacaagaatgattacccagatttgattgtgggtgcatttggaacaggaaaagtcgctgtt
tacagagcaagaccggttgtgactgtagatgcccagcttctgctgcacccaatgattgtc
aatcttgaaaataaaacttgccagattccagactctgtgacatttgcagcctgcttttct
ttaagagtatgtgcatctgtcgcaggccagagcatttcaaacacaatagtcttgatggca
gaggtgcaattagattccctgaaacagaaaggagccattaaacggacactcttccttgat
aaccatcaggctcatcatgtcttccctcttgtgataaaagggcagaaatcccaccagtgc
cgggatttcatcgtttaccttcgagatgaaattgaattccgagataaattatctccaatc
aacattagtttgaattacagtttggacgaatccacctttaaggaaggcctggaagtgaaa
ccaatattgaactactacagggaaaatgttgttagtgaacaggctcacattctggtggac
tgtggagaagacaatctgtgtgttcctgacttgaagctgtcagctagaccagataagcat
caggtaatcattggagatgaaaatcaccttatgctcataataaatgcaagaaatgaaggg
gaaggagcatatgaagctgaactctttgtaatgataccagaagaggcagattatgttggg
atcgaacgcaacaacaagggatttcgaccactgagctgtgagtacaagatggaaaatgta
accaggatggtggtgtgtgaccttgggaaccctatggtgtcgggaacaaattattccctg
ggcctccgatttgcagttccacgtctcgagaaaacaaacatgagcattaacttcgatctc
caaatcagaagttcgaacaaggacaatccagacagcaattttgtgagcctgcaaatcaac
atcactgctgtagcgcaggtggaaataagaggagtatcacaccctccgcagattgttcta
cccattcataactgggaaccagaagaggagccccacaaagaggaggaggttggaccattg
gtggaacatatttacgagctgcacaatattggaccaagtaccatcagtgacaccatcctg
gaggtgggctggcctttctctgcccgggatgaatttcttctctacattttccatattcaa
actctgggacctctgcagtgccaaacgaatcctaatatcaatccacaggatataaagcct
gctgcctccccagagcacacccctgagctcagtgcctttttgcgaaactctaccattcct
catcttgtcaggaagagggatgtgcccgtggttgaattccacagacagagccctgcaaaa
atactgaattgtacaaatatcgagtgtttacaaatctcctgtgcagtgggacgactcgaa
ggaggagaaagcgcagtcctgaaagtcaggtcacgattatgggcccacaccttcctccag
agaaaaaatgatccctatgctcttgcatcgctggtgtcctttgaagttaagaagatgcct
tataaagaccagccagcaaaactcccagaaggaagcatagcaattaagacatcagttatt
tgggcaactccgaatgtttccttctcaatcccattatgggtaataatactagcaatactt
cttggattgttggttctggccattttaaccttagctttatggaagtgtggattctttgac
agagccagacctcctcaagaggacatgaccgacaaggaacagctgacaaatgacaagacc
cccgaggcatga

KEGG   Macaca mulatta (rhesus monkey): 700962
Entry
700962            CDS       T01028                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3 isoform X1
  KO
K06482  integrin alpha 3
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    700962 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    700962 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    700962 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    700962 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    700962 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    700962 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    700962 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    700962 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    700962 (ITGA3)
   05414 Dilated cardiomyopathy
    700962 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    700962 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    700962 (ITGA3)
   04515 Cell adhesion molecules [BR:mcc04515]
    700962 (ITGA3)
   04090 CD molecules [BR:mcc04090]
    700962 (ITGA3)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   700962 (ITGA3)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   700962 (ITGA3)
CD molecules [BR:mcc04090]
 Proteins
  700962 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MLANA
Other DBs
NCBI-GeneID: 700962
NCBI-ProteinID: XP_001095554
Ensembl: ENSMMUG00000000153
UniProt: F7HLW8
LinkDB
Position
16
AA seq 1064 aa
MGPGPSRAPRAPRLMLCALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHRQT
ERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKSDPGHHIIEDM
WLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPSDDWQTYHN
EMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKEWDLSEYSYKDP
EDQGNLYIGYTVQVGSAILHPKNITIVTGAPRHRHMGAVFLLSQEAGGDLRRRQVLEGSQ
VGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGTSFPAHPSLLLH
GPSGSAFGLSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLPRQPQQVIHGEKL
GLPGLATFGYSLSGQMDVDENFYPDLLVGSLSDHIVLLRARPVINIVHKTLVARPAVLDP
ALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFAGSESAVFHGF
FSMPEMRCQKLELLLMDNLRDKLRPIIISMNYSLPLRMPDRPRLGLRSLDAYPILNQAQA
LENHTEVQFQKECGPDNKCESNLQMRAAFVSEQQQKLSRLQYSRDVRKLLLSINVTNTRT
SEHTGEDAHEALLTLVVPPALLLSSVRPPGACQANETIFCELGNPFKRNQRMELLIAFEV
IGVTLHTRDLQVQLQLSTSSHQDNLWPMTLTLLVDYTLQTSLSMVNHRLQSFFGGTVMGE
SGMKTVEDVGSPLKYEFQVGPMGEGLVGLGTLVLGLEWPYEVSNGKWLLYPTEITIHGNG
SWPCQPPGDLVNPLNLTLSDPGDRLSSPQRRRRQLDPGGGQGPPPVTLAAAKKAKSETVL
TCATGRARCVWLECPIPDAPVVTNVTVKARVWNSTFIEDYRDFDRVRVNGWATLFLRTSI
PTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCDFFKRT
RYYQIMPKYHAVRIREEERYPPPGSTLPTKKHWVTSWQTRDRYY
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgggccctggccccagccgcgcgccccgcgccccacgcctgatgctttgcgcgttgatg
gtggcggccggcggctgcgtcgtctccgccttcaacctggatacccgattcctggtagtg
aaagaggccgggaacccgggcagcctcttcggctactcggtcgccctccatcggcagaca
gagcggcagcagcgctacctgctcctggctggtgccccccgggagctcgctgtgcctgat
ggctacaccaaccggactggtgctgtgtacctgtgcccactcactgcccacaaggatgac
tgtgagcggatgaacatcacagtgaaaagtgaccctggccatcacattattgaggacatg
tggcttggagtgactgtggccagccagggccctgcaggcagagtcctggtctgtgcccac
cgctacacccaggtgctgtggtcggggtcagaagaccagcggcgcatggtgggcaagtgc
tacgtgcgaggcaatgacctagagttggaccccagtgacgactggcagacctaccacaac
gagatgtgcaacagcaacactgactacctggagacgggcatgtgccagctgggcaccagc
ggtggcttcacccagaacactgtgtactttggcgcccccggtgcctacaactggaaagga
aacagctacatgattcagcgtaaggagtgggacttatctgagtatagttacaaggaccca
gaggaccaaggaaacctctatattgggtacacggtgcaggtaggcagcgccatcttgcac
cccaaaaacatcaccattgtgacaggtgccccacggcaccgacatatgggcgcggtcttc
ttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggctcgcag
gtgggcgcctattttggcagcgccattgccctggcagacctgaacaacgatgggtggcag
gacctcctggtgggcgccccctactactttgagaggaaagaggaggtagggggtgccgtc
tatgtcttcatgaaccaggcgggaacctccttccctgctcacccctcgcttcttcttcat
ggccccagtggctccgccttcggcttatccgtggccagcattggtgacatcaaccaggat
ggatttcaggatattgctgtgggagctccatttgaaggcttgggcaaagtgtacatctat
cacagtagctctaaggggctccccagacagccccagcaggtaatccacggagagaagctg
ggactgcctggcttggccaccttcggctattccctcagtgggcagatggatgtggatgag
aacttctacccagaccttctagtgggaagcctgtcagaccacattgtgctgctgcgggcc
cggcccgtcatcaacatcgtccacaagaccttggtggccaggcccgctgtgctggaccct
gcactttgcacggccacctcctgtgtgcaagtggagctgtgctttgcttacaaccagagt
gccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggctgacagg
gaccgccgcccgccccggctccgctttgctggcagtgagtctgctgtcttccacggcttc
ttctccatgcccgagatgcgctgccagaagctggagctgctcctgatggacaacctccgt
gacaaactccggcccatcatcatctccatgaactactctttacctttgcggatgcccgat
cgcccccggctggggctgaggtccctggacgcctacccgatcctcaaccaggcacaggct
ctggagaaccacactgaggtccagttccagaaggagtgcgggcctgacaacaagtgtgag
agcaacttgcagatgcgggcagccttcgtgtctgagcagcagcagaagctgagcaggctc
cagtacagcagagacgtccggaaactgctcctgagcatcaacgtgacgaacacccggacc
tcggagcacaccggagaggacgcccacgaggcactgcttaccctggtggtgcctcccgcc
ctgctgctgtcctcagtgcgcccccctggggcctgccaagctaatgagaccatcttttgc
gagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgcctttgaggtc
atcggggtgaccctgcacacaagggaccttcaggtgcagctgcagctctccacgtcaagt
caccaggacaacctgtggcccatgaccctcactctgctggtggactatacactccagacc
tcgcttagcatggtaaatcaccggctacaaagcttctttggggggacagtgatgggcgag
tctggcatgaaaactgtggaggatgtaggaagccccctcaagtacgaattccaggtgggc
ccaatgggggaggggctggtgggcctggggaccctggtcctaggtctggaatggccctat
gaagtcagcaatggcaagtggctgctgtatcccacggagatcaccatccatggcaatggg
tcctggccctgccaaccacctggagaccttgtcaaccctctcaacctcactctttctgac
cctggggacaggctgtcatccccacagcgcaggcggcgacagctggatccagggggaggc
cagggtcccccacctgtcactctggctgctgccaaaaaagccaagtctgagactgtgctg
acctgtgccacagggcgtgcccgctgtgtgtggctggagtgccccatccctgatgccccc
gttgtcaccaacgtgactgtgaaggcacgagtgtggaacagcaccttcattgaggattac
agagactttgaccgagtccgggtaaatggctgggctaccctgttcctccgaaccagtatc
cccaccatcaacatggagaacaagaccacgtggttctccgtggacattgactcggagctg
gtggaggagctgccggctgagatcgagctgtggctggtgctggtggccgtgggtgcgggg
ctgctgcttctggggctgatcattctcctgctgtggaagtgtgacttctttaagaggacc
cgctattaccagatcatgcccaagtaccacgcggtgcggatccgggaggaggagcgctac
ccacctccagggagcaccctacccaccaagaagcactgggtgaccagctggcagactcgg
gaccgatactactga

KEGG   Macaca mulatta (rhesus monkey): 703456
Entry
703456            CDS       T01028                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1
  KO
K06480  integrin alpha 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    703456 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    703456 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    703456 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    703456 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    703456 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    703456 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    703456 (ITGA1)
   05414 Dilated cardiomyopathy
    703456 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    703456 (ITGA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    703456 (ITGA1)
   04515 Cell adhesion molecules [BR:mcc04515]
    703456 (ITGA1)
   04090 CD molecules [BR:mcc04090]
    703456 (ITGA1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   703456 (ITGA1)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   703456 (ITGA1)
CD molecules [BR:mcc04090]
 Proteins
  703456 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 HisK_sensor LYRIC Integrin_alpha VWA_CoxE Cation_ATPase_N
Other DBs
NCBI-GeneID: 703456
NCBI-ProteinID: XP_001094788
Ensembl: ENSMMUG00000001753
LinkDB
Position
6
AA seq 1179 aa
MAPRPRARPGVAVACCWLLTVVLRCCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGK
WVLIGSPLVGQPKNRTGDVYKCPVGRGESLPCVKMDLPVNTSIPNVTEVKENMTFGSTLV
TNPNGGFLACGPLYAYRCGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGS
NSIYPWDSVTAFLNDLLERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAAKKI
VQRGGRQTMTALGIDTARKEAFTEARGARRGVKKVMVIVTDGESHDNHRLKKVIQDCEDE
NIQRFSIAILGSYNRGNLSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVKTLGERIF
ALEATADQSAASFEMEMSQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKASQIIIPRNTT
FNVESTKKNEPLASYLGYTVNSATASSGDVLYIAGQPRYNHTGQVIIYRMEDGNIKILQT
LSGEQIGSYFGSILTTIDIDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQM
SLEPTKQTCCSSRQHNSCTKENKNEPCGARFGTAIAAVKDLNLDGFNDIVIGAPLEDDHG
GAVYIYHGSGKTIRKEYAQRIPSGGDGETLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAA
LFWSRDVAVVKVTMNFEPNKVNIQKKNCHMEGKETVCINATVCFDVKLKSKEDTIYEADL
QYRVTLDSLRQISRSFFSGTQERKVQRNITVRKSECTKHSFYMLDKHDFQDSVRITLDFN
LTDPENGPVLDDSLPNSVHEYIPFAKDCGNKEKCISDLSLHVATTEKDLLIVRSQNDKFN
VSLTVKNTKDSAYNTRTIVHYSPNLVFSGIEAIQKDSCESNHNITCKVGYPFLRKGEMVT
FKILFQFNTSYLMENVTIYLNATSDSEEPPETLSDNVVNISIPVKYEVGLQFYSSASEYH
ISIAANETVPEVINSTEDIGNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPT
GLSSSDNANCRPHIFEDPFSIDSGKKMTTSTDHLKQGTILDCNPCKFATITCNLTPSDMS
QVNVSLILWKPTFIKSYFSSLNLTIRGELRSENTSLVLSSSNQKRELAIQISKDGLPGRV
PLWVILLSAFAGLLLLMLLILALWKIGFFKRPLKKKMEK
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggcccctcggccccgcgcccgcccaggggtcgctgtcgcctgctgctggctcctcact
gttgttctacgctgctgcgtatcattcaatgttgatgtgaaaaattcgatgactttcagc
ggcccagtggaagacatgtttggatatactgttcaacaatatgaaaatgaagaaggaaaa
tgggtgcttattggttctcctttagttggccaacccaaaaacagaactggagatgtctat
aagtgtccagttgggagaggtgaatcattaccttgtgtaaagatggatctaccagttaat
acatcaattcccaatgtcacagaagtaaaagagaacatgacatttggatcaactttagtc
accaacccaaacggaggatttttggcatgtgggcccttatatgcctatagatgtggacat
ttgcattacacaactggaatctgttctgacgtcagtcccacatttcaagtcgtgaattcc
attgcccctgtaagagaatgcagcactcaactggacatagtcatagtgctagatggttcc
aacagtatttacccatgggacagtgttacagcttttttaaatgaccttcttgaaagaatg
gatattggtcctaaacagacacaggttggaattgtacagtatggagaaaacgtgacccat
gagttcaacctcaataagtattcttccaccgaagaggtacttgttgcagcaaagaaaata
gtccagagaggtggccgccagactatgacagctcttggaatagacacagcaagaaaggag
gcattcacggaagcccggggtgcccgaagaggagttaaaaaagtcatggttattgtgacg
gatggagagtcccatgacaaccatcgactgaagaaggtcattcaagactgtgaagatgaa
aacattcaacggttttccatagctattcttggcagctataaccgaggaaatttaagcact
gaaaaatttgtggaggaaataaaatcaattgcaagcgaacccactgaaaagcatttcttc
aatgtctctgatgaattggctctagtcaccattgttaaaactctgggagaaagaatattt
gccctggaagctacagctgaccagtcagcagcttcatttgaaatggaaatgtctcagact
ggcttcagtgctcattattcacaggactgggtcatgcttggagcagtaggagcctatgat
tggaatggaacagttgtcatgcagaaggctagtcaaataatcatccctcgaaacacaacc
tttaacgttgagtctaccaaaaagaatgaaccgcttgcttcttatttaggttacactgta
aactctgctactgcttcttctggagatgtgctctatattgctggacagcctcggtacaat
catacaggccaggtcattatctacaggatggaagatggaaacatcaaaattctccagaca
ctcagtggagaacagattggttcctactttggcagtattttaacaacaattgacattgac
aaggattctaatactgacattcttctagtcggagcccctatgtacatgggaacggagaaa
gaggagcaaggaaaagtgtatgtgtatgctctcaatcagacaaggtttgaatatcaaatg
agcctggaacctactaagcagacgtgctgttcatctcggcagcacaattcatgcacaaaa
gaaaacaaaaatgagccatgcggggctcgttttggaactgctattgctgctgtaaaagat
ctcaatcttgatggatttaatgacatcgtgataggagctccgctggaagatgatcacggg
ggagctgtgtacatttatcatggaagtggcaagacgataaggaaagagtatgcacaacgt
attccatcaggtggggatggtgagacactgaaattttttggccagtctatccacggagaa
atggatttaaatggtgacggcctgacagatgtgactattgggggccttggtggtgctgcc
ctcttctggtcccgagatgtggccgtagttaaagtgaccatgaattttgaaccaaataaa
gtgaatattcaaaagaaaaactgccatatggagggaaaggaaacagtatgcataaatgct
acagtgtgttttgatgtgaaattaaaatctaaagaagacacgatttatgaagctgatttg
cagtaccgtgtcaccctagattcactaaggcaaatatcacgaagttttttctctggaact
caagagagaaaagttcaaaggaacatcacagttcgaaaatcagaatgcactaagcactcc
ttctacatgttggacaagcatgactttcaggactccgtgagaataacgttggactttaat
cttaccgatccagaaaatgggcctgttcttgatgattctctaccgaactcagtacatgaa
tatattccttttgccaaagattgtggaaacaaggaaaaatgtatctcggacctcagcctg
catgtcgccaccacagaaaaggacctgctaattgtccggtcccagaatgataagttcaat
gttagcctcacagtcaaaaatacaaaggacagtgcctacaataccaggacaatagtgcat
tattctccaaatctagttttttcaggaattgaggctatccaaaaagacagttgtgaatcc
aatcataatatcacatgtaaagttggatatcccttcctgagaaaaggagagatggtaact
ttcaaaatattgtttcagtttaacacatcctatctcatggaaaatgtgaccatttattta
aatgcaacaagcgacagtgaagaacctcctgaaaccctttctgataatgtagtaaacatt
tctattccggtaaaatatgaagttggactacagttttacagctctgcaagtgaataccac
atttcaattgctgccaatgagacagtccctgaagttattaattctacggaggacattgga
aatgaaattaatatcttctacctgattagaaaaagtggatcttttccaatgccagaactt
aagctgtcaatttcattccccaacatgacatcaaatggttatcctgtgctatacccaact
ggattgtcatcttctgataatgcaaactgcagaccccatatctttgaggatcctttcagt
atagactctggaaagaaaatgactacatcaactgaccatctcaaacaaggcacaattctg
gactgcaatccatgtaaatttgctaccatcacatgtaatctcactccttctgacatgagc
caagtgaatgtttcacttatcttgtggaaaccaacttttataaaatcatatttttccagc
ttaaatcttactataaggggagaacttcggagtgaaaatacatcactggttttaagtagc
agcaatcaaaaaagagagcttgctattcaaatatccaaagatggactaccgggcagagtg
ccattatgggtcatcctgctgagtgcttttgctggattattgctgttaatgctgctcatt
ttagcactgtggaagattggattcttcaaaagaccactgaaaaagaaaatggagaaatga

KEGG   Macaca mulatta (rhesus monkey): 703572
Entry
703572            CDS       T01028                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2 precursor
  KO
K06481  integrin alpha 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04611  Platelet activation
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    703572 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    703572 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    703572 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    703572 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    703572 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    703572 (ITGA2)
   04611 Platelet activation
    703572 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    703572 (ITGA2)
   05205 Proteoglycans in cancer
    703572 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    703572 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    703572 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    703572 (ITGA2)
   05414 Dilated cardiomyopathy
    703572 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    703572 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    703572 (ITGA2)
   04515 Cell adhesion molecules [BR:mcc04515]
    703572 (ITGA2)
   04090 CD molecules [BR:mcc04090]
    703572 (ITGA2)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   703572 (ITGA2)
  Exosomal proteins of bladder cancer cells
   703572 (ITGA2)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   703572 (ITGA2)
CD molecules [BR:mcc04090]
 Proteins
  703572 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 703572
NCBI-ProteinID: NP_001247751
Ensembl: ENSMMUG00000020448
UniProt: G7MTQ0 A0A5S6RAX0
LinkDB
Position
6
AA seq 1180 aa
MGPGRTGSSPLPLLLVLALSQGILNCCLAYNVGLPEAKIFSGPSSEQFGYAVQQFINPKG
NWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLT
RNMGTGGFLTCGPLWAQQCGNQYYTTGVCSDISPDFQLSASFSPAAQPCPSLIDVVVVCD
ESNSIYPWDAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTYKTKEEMIVATS
QTSQHGGDLTNTFGAIQYARKYAYSAASGGRRSATKVMVVVTDGESHDGSMLKAVIDQCN
HDNILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQ
IFSIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAFGWSGTIVQKTSHGHLIFP
KQAFDQILQDRNHSSYLGYSVAAISTGESTHFVAGAPRANYTGQIVLYSVNENGNVTVIQ
AHRGDQIGSYFGSVLCSVDVDKDTITDVLLVGAPMYMNDLKKEEGRVYLFTIKKGILSQH
QFLEGPEGIENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHQGTVRTKY
SQKILGSDGAFRSHLQYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADIAIEAS
FTPEKITLVNKNAQIILKLCFSAKFRPTKQNNQVAIVYNITLDADGFSSRVTSRGLFKEN
NERCLQKNMVVNQAQSCPEHIIYIQEPSDVVNSLDLRVDISLENPGTSPALEAYSETTKV
FSIPFHKDCGEDGLCIADLVLDVRQIPAAQEQPFTVSNQNKRLTFSVTLKNKRESAYNTG
IVVDFSENLFFASFSLPVDGTEVTCQVAASQKSVACDVGYPALKREQQVTFTINFDFNLQ
NLQNQASLSFQALSESQEENEPDNLVNLKIPLLYDAEIHLTRSTNINFYEISSDGNVPSI
VHSFEDIGPKFIFSLKVTTGSVPVSMATVIIHIPQYTKEKNPLMYLTGVQTDKAGDISCN
ADINPLKIGQTSSVSFKSENFRHTKELNCRTASCSNVTCWLKDLHMKGEYFVNVTTRIWN
GTFASSTFQTVQLTAAAEINTYNPEIYVIEDNTVTIPLMIMKPDEKAEVPIGVIIGSIIA
GILLLLALVAILWKLGFFKRKYEKMTKNPDEIDETTELNS
NT seq 3543 nt   +upstreamnt  +downstreamnt
atgggaccaggacggacagggtcctcgccgctgccgctgctgctggtgttagcgctcagt
caaggcattttaaattgttgtttggcatacaatgttggtctcccagaagcaaaaatattt
tccggtccttcaagtgaacagtttggctatgcagtgcagcagttcataaatccaaaaggc
aactggttacttgttggttcaccctggagtggctttcctgagaaccgaatgggagatgtg
tataagtgtcctgttgacctatccactgccacatgtgaaaaactaaatttgcaaacttca
acaagcattccaaatgttactgagatgaaaaccaacatgagcctcggcttgaccctcaca
aggaacatgggaactggagggtttctcacatgtggtcctctgtgggcacagcagtgtggg
aatcagtattacacaacgggtgtgtgttctgacatcagtcctgattttcagctctcagcc
agcttctcacctgcagctcagccgtgcccttccctcatagatgttgtggttgtgtgtgat
gaatcaaatagtatttatccttgggatgcagtgaagaattttttggaaaaatttgtacaa
ggcctggatataggccccacaaagacacaggtgggattaattcagtatgccaataatcca
agagttgtgtttaacttgaacacatataaaaccaaagaagaaatgattgtagcaacatcc
cagacatcccaacatggtggggacctcacaaacacattcggagcaattcaatatgcaaga
aaatatgcttattcagcagcttctggtggacgacgaagtgctaccaaagtaatggtagtt
gtaactgatggtgaatcacatgatggttcaatgttgaaagctgtgattgatcaatgcaac
catgacaatatactgaggtttggtatagcagttcttgggtacttaaacagaaatgccctt
gatactaaaaatttaataaaagaaataaaagcaatcgctagtattccaacagaaagatac
tttttcaatgtgtctgatgaagcagctctactagaaaaggctgggacattaggagaacaa
attttcagcattgaaggtaccgttcaaggaggagacaactttcagatggaaatgtcacaa
gtgggattcagtgcagattactctcctcaaaatgatattctgatgctgggtgcagtggga
gcttttggctggagtgggaccattgtccagaagacatctcatggccatttgatctttcct
aaacaggcctttgaccaaattctgcaggacagaaatcacagttcatatttaggttactct
gtggctgcaatttctactggagaaagcacccactttgttgctggtgctcctcgggcaaat
tatactggccagatagtgctgtacagtgtgaatgagaatggcaatgtcacagttattcag
gctcaccgaggtgaccagattggctcctatttcggtagcgtgctatgttcagttgatgtg
gataaagacaccattacagatgtgctcttggtaggtgcaccaatgtacatgaatgaccta
aagaaagaggaaggaagagtctacctgtttactatcaaaaagggcattttgagtcagcac
caatttcttgaaggccccgagggcattgaaaatgctcgatttggttcagcaattgcagct
ctttcagacatcaacatggatggctttaacgatgtgattgttggttcgccactagaaaat
cagaattctggagctgtatacatttataatggtcatcagggcactgtccgcacgaagtat
tcccagaaaatcttgggatccgatggagcctttaggagccatctccagtactttgggagg
tccttggatggctatggagatttaaatggggattccatcactgatgtgtccattggtgcc
tttggacaagtggttcaactctggtcacaaagtattgctgatatagctatagaagcttca
ttcacaccagaaaaaatcactttggtcaataagaatgctcagataattctcaaactctgc
ttcagtgcaaagttcagacctactaagcaaaacaatcaagtggccattgtatataacatc
acacttgatgcagatggattttcatccagagtaacctccagggggttatttaaagaaaac
aatgaaaggtgcctgcagaagaatatggtagtaaatcaagcacagagttgccccgagcac
atcatttatatacaggagccctctgatgttgtcaactctttggatttgcgtgtggacatc
agtctggaaaaccctggcactagccctgcccttgaagcctattctgagactaccaaggtc
ttcagtattcctttccacaaagactgtggtgaggatggactttgcattgctgatctagtt
ctagatgtccgacaaataccagctgctcaagaacaaccctttactgtcagcaaccaaaac
aaaaggttaacattttcagtaacactgaaaaacaaaagggaaagtgcatacaacactgga
attgttgttgatttttcagaaaacttgttttttgcatcattctccctgccggttgatggg
acagaagtaacatgccaggtggctgcatctcagaagtctgttgcctgtgatgtaggctac
cctgctttaaagagagaacaacaggtgacctttactattaacttcgacttcaatcttcaa
aaccttcagaatcaggcatctctcagtttccaagccttaagtgaaagccaagaagaaaac
gagcctgataatttggtcaacctcaaaattcctctcctgtatgatgctgaaattcactta
acaagatctaccaacataaatttttatgaaatctcttcggatgggaatgttccttcaatc
gtgcacagttttgaagatattggtccaaaattcatcttctccctgaaggtaacaacagga
agtgttccagtaagcatggcaactgtaatcatccacatccctcaatataccaaagaaaag
aacccactgatgtacctaactggggtgcaaacagacaaggctggtgacatcagttgtaat
gcagatatcaatccactgaaaataggacaaacatcttctgtatctttcaaaagtgaaaat
ttcaggcacaccaaagaattgaactgcagaactgcttcctgtagtaatgttacctgctgg
ttgaaagaccttcacatgaaaggagaatactttgttaatgtgactacaagaatttggaac
gggacttttgcatcatcaacgttccagacagtacagctaacggcagctgcagaaatcaac
acctacaaccccgagatatacgtgatcgaagataacactgtgacgattcccctgatgata
atgaaacctgatgagaaagccgaagtaccaataggagttataataggaagtataattgct
ggaatccttttgctgttagctctggttgcaattttatggaagctcggcttcttcaaaaga
aaatatgaaaagatgaccaaaaatccagatgagattgacgagaccacagaactcaatagc
tga

KEGG   Macaca mulatta (rhesus monkey): 704745
Entry
704745            CDS       T01028                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04640  Hematopoietic cell lineage
mcc04670  Leukocyte transendothelial migration
mcc04672  Intestinal immune network for IgA production
mcc04810  Regulation of actin cytoskeleton
mcc05135  Yersinia infection
mcc05140  Leishmaniasis
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    704745 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    704745 (ITGA4)
   04514 Cell adhesion molecules
    704745 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    704745 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    704745 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    704745 (ITGA4)
   04670 Leukocyte transendothelial migration
    704745 (ITGA4)
   04672 Intestinal immune network for IgA production
    704745 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    704745 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    704745 (ITGA4)
   05414 Dilated cardiomyopathy
    704745 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    704745 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    704745 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    704745 (ITGA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    704745 (ITGA4)
   04515 Cell adhesion molecules [BR:mcc04515]
    704745 (ITGA4)
   04090 CD molecules [BR:mcc04090]
    704745 (ITGA4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   704745 (ITGA4)
  Exosomal proteins of other cancer cells
   704745 (ITGA4)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   704745 (ITGA4)
CD molecules [BR:mcc04090]
 Proteins
  704745 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 704745
NCBI-ProteinID: XP_001100929
Ensembl: ENSMMUG00000000300
UniProt: F6Z0X3
LinkDB
Position
12
AA seq 1032 aa
MAWEARREPGPRRAALRETVMLLLCLGVPTGRPYNVDTESALLYQGPPNTLFGYSVVLHS
QGANRWLVVGAPTANWLANASVINPGAIYRCRIGKNPGRTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGMPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
RQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFGIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNEMETNLVG
SDKYAARFGECIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGVSSAFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLSHPESVN
RTKFDCVENGWPSVCMDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKTESPPRFYFSSNGT
SDVITGSIQVSSGVANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIIKKTISFARFCAHENCSADLQVSAKIGFFKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPMGLYFIKILELEEKQINCEVTDNSGMVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLNITVHATCENEGEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPEMCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMHTLKGMFQFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATSFPEPNSRVIELNKDENVA
HVLLEGLHHQRPKRYFTIVIISSSLLLGLIVLLLISYVMWKAGFFKRQYKSILQEENRRD
SWSYINSKSNDD
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcttgggaagcgaggcgcgaacctggtccccgaagggccgccctccgggagacggtg
atgttgttgctgtgcctgggggtcccgaccggccgcccctacaacgtggacactgagagc
gcgctgctttaccagggcccccccaacacgctgttcggctactcggtcgtgctgcacagc
caaggggcgaacagatggctcgtggtgggtgcgcccactgccaactggctcgccaacgct
tcagtgatcaatcccggggcgatttacagatgcaggatcgggaagaatcccggccggacg
tgcgaacagctccagctgggtagccctaatggagaaccttgtggaaagacttgtttggaa
gagagagacaatcagtggttgggggtcacactttccagacagccaggagaaaatggatcc
atcgtgacttgtgggcatagatggaaaaatatattttacataaagaatgaaaataagctc
cccactggtggttgctatggaatgccccctgatttacgaacagaactgagtaaaagaata
gctccgtgttatcaagattatgtgaaaaaatttggagaaaattttgcatcatgtcaagct
ggaatatctagtttttacacaaaggatttaattgtgatgggagccccaggatcatcttat
tggactggctctctttttgtctacaatataactacaaataaatacaaggcttttttagac
agacaaaatcaagtaaaatttggaagttatttaggatattcagttggagctggtcatttt
cggagtcagcatactactgaagtagttggaggagctcctcaacacgagcagattggtaaa
gcatatatattcggcattgatgaaaaagaactaaatatcttacatgaaatgaaaggtaaa
aagcttggatcgtactttggagcttctgtctgtgctgtggaccttaacgcagatggcttc
tcagatctgctcgtgggagcgcccatgcagagcaccatcagagaggaaggaagagtgttt
gtgtacatcaactccggctcgggagcagtaatgaatgaaatggaaacaaacctcgttgga
agtgacaaatatgctgcaagatttggcgaatgtatagttaatcttggtgacattgacaat
gatggctttgaagatgttgctattggagctccacaagaagatgacttgcaaggtgctatt
tatatttacaatggccgtgcagatggggtctcatcagccttctcgcagagaatcgaagga
cttcagatcagcaaatcgttaagtatgtttggacagtctatatcaggacaaattgatgca
gataataatggatatgtagatgtagcagttggtgcttttcggtctgattctgctgtgttg
ctaaggacaagacctgtagtcattgttgaagcttctttaagccaccctgagtcagtaaat
agaacgaaatttgactgtgttgaaaatggatggccttctgtgtgcatggatctaacactt
tgtttctcatataagggcaaggaagttccaggttacattgttttgttttataacatgagt
ttggatgtgaacagaaagacagagtctccaccaagattctatttttcttctaatggaact
tctgacgtgattacaggaagcatacaagtgtccagcggagtagctaactgtagaacacat
caagcatttatgcggaaagatgtgcgggacatccttaccccaattcagattgaagctgct
taccaccttggtcctcacgtcatcagtaaacgaagcacagaggaattcccaccacttcag
ccaattcttcagcagaagaaagaaaaagacataattaaaaaaacaataagctttgcaagg
ttttgtgcccatgaaaattgttctgctgatttacaggtttctgcaaagattgggtttttc
aagccccatgaaaataaaacctaccttgctgttgggagtatgaagacattaatgttgaat
gtgtccttgtttaatgctggagatgatgcatatgaaacgactctacatgtcaaactaccc
atgggtctttacttcattaagattttagagctggaagagaagcaaataaactgtgaagtc
acagataactctggcatggtacaacttgactgcagtattggctatatatatgtagatcat
ctctcaaggatagatattagctttctcctggatgtgagctcactcagcagagcggaagag
gacctcaatatcacagtgcatgctacctgtgaaaatgaaggggaaatggacaatctaaag
cacagcagagtgactgtagcaatacctttaaaatatgaggttaagctgactgttcatggg
tttgtaaacccaacttcatttgtgtatggatcaaatgatgaaaatgagcctgaaatgtgc
atggtggagaaaatgaacttaactttccatgttatcaacactggcaatagcatggctcct
aatgttagtgtggaaataatggtaccaaattctttcagcccccaaactgataagctgttc
aacattttggatgtccagactactactggagaatgccactttgaaaattatcaaagagta
tgtgcattagagcagcaaaagagtgcaatgcacaccttgaaaggcatgttccagttcttg
tccaagactgataagaggctattgtactgcataaaagctgatccacattgtttaaatttc
ctatgtaatttcgggaaaatggaaagtggaaaagaagccagtgttcatatccagttggaa
ggccgaccatccattttagaaatggatgagacttcagcactcaaatttgaaataagagca
acaagttttccagagccaaattcaagagttattgaactaaacaaggatgagaatgttgca
catgttctcctggaaggactacatcatcaaagacccaaacgttatttcaccatagtgatt
atttcaagtagcttgctacttggacttattgtacttctgttgatctcatatgttatgtgg
aaggccggcttctttaaaagacaatacaaatctatcctacaagaagaaaacagaagagac
agttggagttacatcaacagtaaaagcaatgatgattaa

KEGG   Macaca mulatta (rhesus monkey): 707279
Entry
707279            CDS       T01028                                 

Gene name
ITGA7
Definition
(RefSeq) integrin alpha-7 isoform X1
  KO
K06583  integrin alpha 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    707279 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    707279 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707279 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707279 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    707279 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    707279 (ITGA7)
   05414 Dilated cardiomyopathy
    707279 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    707279 (ITGA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    707279 (ITGA7)
   04515 Cell adhesion molecules [BR:mcc04515]
    707279 (ITGA7)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   707279 (ITGA7)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   707279 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF3488
Other DBs
NCBI-GeneID: 707279
NCBI-ProteinID: XP_028685413
Ensembl: ENSMMUG00000013226
LinkDB
Position
11
AA seq 1122 aa
MAGARSRDPWGASWICYLLGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPGPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADVQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSADLAH
LDDGPYEAGGEKEQDPRLIPVPANSYFGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVI
LRKDSASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVY
VYLNQGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHG
SSLGVVAKPSQVLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTVVLFRARPVLH
VSHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRL
RGQVPRVTFLSRSPDEPKHQASGTVWLKHQHDRVCGDAMFQLQDNVKDKLRAIVVTLSYS
LQTPRLRRQAPGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCA
RVSDTEFQPLPMDADGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVM
LPDSLHYSGVRALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETT
ELEVELLLATISEQELHPVSARARVFIELPLSIAGMATPQQLFFSGVVRGERAMQSERDV
GSKVKYEVTVSNQGQSLKTLGSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPGQKGLCS
PRPNILHLDVDSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTAN
CVVFSCPLYSFDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDA
SIVIPVMVYLDPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKCGFFHRSSQSSPFPT
NYHRACLAVQPSAMEVGGPGTVGWDSSNGRSTPRPPCPSTMR
NT seq 3369 nt   +upstreamnt  +downstreamnt
atggccggggctcggagccgcgacccttggggggcctcctggatttgctaccttcttggc
tccctgctcgtcgaactgctcttctcacgggctgtcgccttcaatctggacgtgatgggt
gccttgcgcaaggagggcgagccaggcagcctcttcggcttctctgtggccttgcaccgg
cagttgcagcccggaccccagagctggctgctggtgggtgctccccaggccctggctctt
cctgggcagcaggcgaatcgcactggaggcctcttcgcttgccccttgagtctggaggag
accgactgctacagagtggacatcgaccagggagctgatgtgcaaaaggaaagcaaggag
aaccagtggttgggagtcagtgttcggagccaggggcctgggggcaagattgttacctgt
gcacaccgatatgaggcaaggcagcgagtggaccagatcctggagacacgggatatgatt
ggtcgctgctttgtgctaagccaggacctggccatccgggatgagttggatggtggggaa
tggaagttctgtgaggggcgcccccaaggccatgaacaatttgggttctgccagcagggc
acagctgccgccttctcccctgatagccactacctcctctttggggccccaggaacctat
aattggaagggcacggccagggtggagctctgtgctcagggctcagcggacctggcacac
ctggacgacggtccctacgaggcggggggtgagaaggagcaggacccccgcctcatcccg
gtccctgccaacagctactttggcttctctattgactcggggaaaggtctggtgcgtgca
gaagagctgagctttgtggctggggccccccgtgccaaccacaagggtgctgtggtcatc
ctgcgcaaggacagcgccagtcgcctggtgcctgaggttatgctgtctggggagcgcttg
acctccggcttcggctactcgctggctgtggctgacctcaacagtgatggctggccagac
ctgatagtgggtgccccctacttctttgagcgccaagaagagctggggggtgccgtgtat
gtgtacttgaaccaggggggtcactgggctgggatctcccctctccggctctgcggctcc
cctgactccatgttcgggatcagcctggctgtcctgggggacctcaaccaagatggcttt
ccagatattgcagtgggcgccccctttgatggtgatggtaaagtcttcatctaccatggg
agcagcctgggggttgtcgccaaaccttcgcaggtgctggagggcgaggctgtgggcatc
aagagcttcggctactccctgtcaggcagcttggatatggatgggaaccaataccctgac
ttgctggtgggctccctggctgacactgtcgtgctcttcagggccagacccgtcctccat
gtctcccatgaggtctctattgctccacgaagcattgacctggagcagcccaactgtgct
ggcggccactcggtctgcgtggacctaagggtctgtttcagctacattgcagtccccagc
agctacagccctactgtggccctggactacgtgttagacgcggacacagaccggagactc
cggggccaggttccccgtgtgaccttcctgagccgtagcccagatgaacccaagcaccaa
gcctcaggcaccgtgtggctgaagcaccagcatgaccgagtctgtggagatgccatgttc
cagctccaggataatgtcaaagacaagcttcgggccattgtagtgaccttgtcctacagt
ctccagacccctcggctccggcgacaggctcctggccaggggctgcctccagtggccccc
atcctcaatgcccaccagcccagcacccagcgggcagagatccacttcctgaagcaaggc
tgtggtgaagacaagatctgccagagcaatctgcagctggtccgcgcccgcttctgtgcc
cgggtcagcgacacggaattccagcctctgcccatggatgcggatggaacaacagccctg
tttgcactgagtgggcagccagtcattggcctggagctgatggtcaccaacctgccatcg
gacccagcccagccccaggctgatggggatgatgcccatgaagcccagctcctggtcatg
cttcctgactcactgcactactcaggagtccgggccctggaccctgcggagaagccactc
tgcctgtccaacgagaatgcctcccatgttgagtgtgagctggggaaccccatgaagaga
ggtgcccaggtcaccttctacctcattcttagcacctcagggatcagcattgagaccacg
gaactggaggtagagctgctgttggccacgatcagtgagcaggagctgcatccagtctct
gcacgagcccgtgtcttcattgagctgccactgtccattgcagggatggccactccccag
caactcttcttctctggcgtggtgaggggtgagagagccatgcagtctgagcgggatgtg
ggcagcaaggtcaagtatgaggtcacggtttccaatcaaggccagtcgctcaaaaccctg
ggctctgccttcctcaacatcatgtggcctcatgagattgccaatgggaagtggttgctg
tacccaatgcgggtggagctggagggcgggcaggggcctgggcagaaagggctttgctct
cccaggcccaacatcctccacctggatgtggacagtagggataggaggcggcgggagctg
gagccgcctgagcagcaggagcctggtgagcggcaggagcccagcatgtcctggtggccg
gtgtcctctgctgagaagaagaaaaacatcaccctggactgcgcccggggcacggccaac
tgtgtggtgttcagctgcccactctacagctttgaccgcgcggctgtgttgcatgtctgg
ggccgtctctggaacagcaccttcctggaggagtactcagctgtgaagtccctggaagtc
attgtccgggccaacatcacagtgaagtcctccataaagaacttgatgctccgagatgcc
tccatagtgatcccggtgatggtatacttggaccccatggctgtggtggcagaaggagtg
ccctggtgggtcatcctcctggctgtactggctgggctgctggtgctagcactgctggtg
ctgctcttgtggaagtgtggcttcttccatcggagcagtcagagctcaccttttcccacc
aactatcaccgggcctgtctggctgtgcagccttcagccatggaagttgggggtccaggg
actgtgggatgggattcttcaaacgggcgaagcaccccgaggccaccgtgccccagtacc
atgcggtga

KEGG   Macaca mulatta (rhesus monkey): 707756
Entry
707756            CDS       T01028                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V precursor
  KO
K06487  integrin alpha V
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04145  Phagosome
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04514  Cell adhesion molecules
mcc04810  Regulation of actin cytoskeleton
mcc04919  Thyroid hormone signaling pathway
mcc05163  Human cytomegalovirus infection
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05205  Proteoglycans in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    707756 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    707756 (ITGAV)
   04514 Cell adhesion molecules
    707756 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    707756 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    707756 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    707756 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    707756 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    707756 (ITGAV)
   05205 Proteoglycans in cancer
    707756 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    707756 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    707756 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    707756 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    707756 (ITGAV)
   05414 Dilated cardiomyopathy
    707756 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    707756 (ITGAV)
   05165 Human papillomavirus infection
    707756 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mcc04131]
    707756 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    707756 (ITGAV)
   04515 Cell adhesion molecules [BR:mcc04515]
    707756 (ITGAV)
   04090 CD molecules [BR:mcc04090]
    707756 (ITGAV)
Membrane trafficking [BR:mcc04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    707756 (ITGAV)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   707756 (ITGAV)
  Exosomal proteins of epithelial cells
   707756 (ITGAV)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   707756 (ITGAV)
CD molecules [BR:mcc04090]
 Proteins
  707756 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 707756
NCBI-ProteinID: NP_001252882
Ensembl: ENSMMUG00000019462
UniProt: H9ETF2
LinkDB
Position
12
AA seq 1048 aa
MASPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTELKQEREPVGTCFLQDGTKTVEYAPCRSQDIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSIYNFTGD
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVY
PSILNQDNKTCSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRR
ALFLYSRSPSHSKNMTISRGGLMQCEELIAYLRDESEFRDKLTPITIFMEYWLDYRTAAD
TTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVFVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIVSIPLQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQATEKNDTVAGQGERDHLITKRDLALSEGDIH
TLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIE
FPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGF
FKRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3147 nt   +upstreamnt  +downstreamnt
atggcttctccgccgcggcgacggctgcgcctcggtccccgcggcctcccgcttcttctc
tcgggactcctgctacctctgtgccgcgccttcaacctagacgtggacagtcctgccgag
tactctggccccgagggaagttacttcggcttcgccgtggatttcttcgtgcccagcgcg
tcttcccgcatgtttcttctcgtgggagctcccaaagcaaacacgacccagcctgggatt
gtggaaggagggcaagtcctcaaatgtgactggtcttcaacccgccggtgccagccaatt
gaatttgatgcaacaggcaatagagattatgccaaggatgatccattggaatttaagtcc
caccagtggtttggagcatctgtgaggtcgaaacaagataaaattttggcctgtgcccca
ttgtaccattggaggactgagttgaaacaggagcgagagcctgttggaacatgctttctt
caagatggaacaaagactgttgagtatgctccatgcagatcacaagatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagcttttattggcaaggtcagcttatttcggatcaagtggcagaa
atcgtatctaaatatgaccccaatgtttacagcatcaagtataataaccaattagcaact
cggactgcacaagctatttttgatgacagttatttgggttactctgtggctgtcggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaagaacatgtcctccatatacaattttactggcgat
cagatggctgcatatttcgggttttctgtagctgccactgacattaatggagatgattat
gcagatgtgtttattggagcacctctcttcatggatcgtggctctgatggcaaactccag
gaggtggggcaggtctcagtgtctctacagagagcttcaggagacttccagacaacaaag
ctgaatgggtttgaggtctttgcacggtttggcagtgccatcgctcctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatatcttcaatggaagatcaactggcttgaacgcagtcccatctcaaatc
cttgaagggcagtgggctgctcgaagcatgccaccaagctttggctattcaatgaaagga
gccacagatatagacaaaaatggatatccagacttaattgtaggagcttttggtgtagat
cgagctatcttatacagggcccgaccagttatcactgtaaatgctggtcttgaagtgtac
cctagcattttaaatcaagacaataaaacctgctcactgcctggaacagctctcaaagtt
tcctgctttaatgttaggttctgcttaaaggcagatggcaaaggagtacttcccagaaag
cttaatttccaggtggaacttcttttggataaactcaagcaaaagggagcaattcgacga
gcactgtttctctacagcaggtccccaagtcactccaagaacatgactatttcaaggggg
ggactgatgcagtgtgaggaattgatagcatatctgcgggatgaatctgaatttagagac
aaactcactccaattaccatttttatggaatattggttggattatagaacagctgctgat
acaacaggcttgcaacccattcttaaccagttcacgcctgctaacattagtcgacaggct
cacattctacttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttttgta
gatagtgatcaaaagaagatctatattggggatgacaaccctctgacattgattgttaag
gctcagaatcaaggagaaggtgcctatgaagctgagctcatcgtttccattccactgcag
gctgatttcattggggttgtccgaaacagtgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaactcgccaggtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagtgtgcaccagcagtcagagatggatacttct
gtgaaatttgacttacaaatccaaagctcaaatctgtttgacaaagtaagcccggttgta
tctcacaaagttgaccttgctgttttagctgcagttgagataagaggagtctcgagtcct
gatcatatctttcttccgattccaaactgggagcacaaggagaaccctgagactgaagaa
gacgttgggccagttgttcagcacatctatgagctgagaaacaatggtccaagttcattc
agcaaggcaatgctccatcttcagtggccttataaatacaacaataatactctgttgtat
atccttcattatgatattgatggaccaatgaactgcacttcagatatggagatcaaccct
ttgagaattaagatttcatctttgcaagcaactgaaaagaatgacacagttgctgggcaa
ggtgagcgggaccatctcatcactaagcgggatcttgccctcagtgaaggagatattcac
actttgggttgtggagtcgctcagtgcttgaagattgtctgccaagttggaagattagac
agaggaaagagtgcaatcttgtacgtaaagtcattactgtggactgagacctttatgaat
aaggaaaatcagaatcattcctattctctgaagtcatctgcttcatttaatgtcatagag
tttccttataaaaatcttccaattgaggatatcaccaactccacattggttaccactaat
gtcacctggggcattcagccagcacccatgcctgtgcctgtgtgggtgatcattttagca
gttcttgcaggattgttgctactggctgttttggtatttgtaatgtacaggatgggcttt
tttaaacgggtccggccacctcaagaggaacaagaaagggaacaacttcaacctcatgaa
aatggtgaaggaaactcagaaacttaa

KEGG   Macaca mulatta (rhesus monkey): 714955
Entry
714955            CDS       T01028                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb isoform X2
  KO
K06476  integrin alpha 2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04015  Rap1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04510  Focal adhesion
mcc04512  ECM-receptor interaction
mcc04611  Platelet activation
mcc04613  Neutrophil extracellular trap formation
mcc04640  Hematopoietic cell lineage
mcc04810  Regulation of actin cytoskeleton
mcc05165  Human papillomavirus infection
mcc05200  Pathways in cancer
mcc05222  Small cell lung cancer
mcc05410  Hypertrophic cardiomyopathy
mcc05412  Arrhythmogenic right ventricular cardiomyopathy
mcc05414  Dilated cardiomyopathy
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    714955 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    714955 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    714955 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    714955 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    714955 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    714955 (ITGA2B)
   04611 Platelet activation
    714955 (ITGA2B)
   04613 Neutrophil extracellular trap formation
    714955 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    714955 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    714955 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    714955 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    714955 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    714955 (ITGA2B)
   05414 Dilated cardiomyopathy
    714955 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    714955 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mcc01009]
    714955 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    714955 (ITGA2B)
   04515 Cell adhesion molecules [BR:mcc04515]
    714955 (ITGA2B)
   04090 CD molecules [BR:mcc04090]
    714955 (ITGA2B)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     714955 (ITGA2B)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   714955 (ITGA2B)
Cell adhesion molecules [BR:mcc04515]
 Integrins
  Integrin alpha subunits
   714955 (ITGA2B)
CD molecules [BR:mcc04090]
 Proteins
  714955 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 714955
NCBI-ProteinID: XP_001114526
Ensembl: ENSMMUG00000012659
LinkDB
Position
16
AA seq 1090 aa
MSPGAIALCSAHCSASYLGLQFDKKRLPVEESEGKKEELVHSCLGGCGRRKMARALCPLQ
ALWLLEWVLLLLGPCAAPPAWALNLDPVHLTFYAGPNGSHFGFSLDFHKDSHGRVAIVVG
APRTLGPSQEETGSVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVV
SWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVKN
NFSSDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPIADIFSSYRPGILLWHVSS
QSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILGSYFQRLH
RLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPH
TLGAPSLLLTGTQLYGRFGSAIAPLGDLDQDGYNDIAVAAPYGGPSGRGQVLVFLGQSEG
LSSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASV
QLLVQDSLNPAVKSCVLPQTKTPVSCFKIQMCVGATGHNIPQKLSLNAELQLDRQKPRQG
RRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEAEFRDKLSPIVLSLNVSLPPTEA
GMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDTA
NEGEGAYEAELSVHLPQGAHYMRARSNVEGFERLICNQKKENETRVVLCELGNPMKKNTQ
IGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPAS
LVVAAEEGDREQNSLDSRGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQHSDLLYILDI
QPQGGLQCFPQPPVNPLKVDWGLPTPSPSPVHPAHHKRDRRQIFLPEPEQPSRLQDPVLV
SCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLHQRPLDQFVLQSQAWFNVSSLPYA
VPPLSLPRGEAQVRTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRP
PLEEDDEEGE
NT seq 3273 nt   +upstreamnt  +downstreamnt
atgagtccaggggctatagccctttgctctgcccattgctcagcaagttacttggggttg
cagtttgataagaaaagacttcctgtggaggaatctgaagggaagaaggaggagctggtc
cattcctgcctgggaggttgtggaagaaggaagatggccagagctttgtgtccactgcaa
gccctctggcttctggagtgggtgctgctgctcttgggaccttgtgctgcccctccagcc
tgggccttgaacctggacccagtgcatctcaccttctatgcaggccccaatggcagccac
tttgggttttcactggacttccacaaggacagccatgggagagtggccatcgtggtgggc
gccccacggacgctgggtcccagccaggaggagacgggcagcgtgttcctgtgcccctgg
agggccgagggcggccagtgcccctcgctactctttgacctccgtgatgagacccgaaat
gtaggctcccaaactttacaaaccttcaaggcccgccaaggactaggggcgtcggtcgtc
agctggagcgacgtcattgtggcctgcgccccctggcagcactggaacgtcctagaaaag
accgaggaggctgagaagacgcccgtaggcagctgctttttggctcagccagagagcggc
cgccgcgccgagtactccccctgtcgcgggaacactctgagccgcatttacgtgaaaaat
aattttagctcggacaagcgttactgtgaagcgggcttcagctccgtggtcactcaggcc
ggggagctggtgcttggggctcctggaggctattatttcttaggtctcctggcccaggct
ccaattgcggatattttctcgagttaccgcccaggcatccttttgtggcacgtgtcctcc
cagagcctctccttcgactccagcaacccagagtacttcgacggctactgggggtactcg
gtggccgtgggcgagttcgacggggatctcaacactacagagtatgtcgtcggtgccccc
acttggagctggacgctgggagcggtggaaattttgggctcctacttccagaggctgcac
cggctacatggagagcagatggcttcgtattttgggcattcagtggctgtcactgacgtc
aacggggatgggaggcatgacctgctggtgggcgctccactgtatatggagagccgggca
gaccgaaaactggccgaagtggggcgtgtgtatttgttcctgcagccgcgaggcccccac
acgctgggtgcccccagcctcctgctgactggcacacagctctatgggcgattcggctct
gccatcgcacccctgggcgacctcgaccaggatggctacaatgacattgcagtggctgcc
ccctacgggggtcccagtggccggggccaagtgctggtgttcctgggtcagagtgagggg
ctgagttcacgtccctcccaggtcctggacagccccttccccacaggctctgcctttggc
ttctcccttcgaggtgctgtagacatcgatgacaacggatacccagacctgattgtggga
gcttacggggccaaccaggtggctgtgtacagagctcagccagtggtgaaggcctccgtc
cagctactggtacaagattcactgaatcctgctgtgaagagctgtgtcctaccccagacc
aagacacccgtgagctgcttcaaaatccagatgtgtgttggagccactgggcacaacatt
cctcagaagctgtccctaaatgccgagctgcagttggaccggcagaagccccgccagggc
cggcgggtgctgctgctgggctctcaacaggcaggcaccaccctgaacctggatctgggc
ggaaagcacagccccatctgccacaccaccatggccttccttcgagatgaggcagaattc
cgggacaagctgagccccattgtgctcagcctcaatgtgtccctgccgcccacggaggct
ggaatggcccctgctgtcgtgctgcatggagacacccatgtgcaggagcagacacgaatc
gtcctggactgcggggaagatgacgtgtgtgtgccccagcttcagctcactgccagcgtg
acaggctccccgctcctagttggggcagataatgtcctggagctgcagatggacacagcc
aacgagggcgagggagcctatgaagcagagctgtccgtgcacctgccccagggggcccac
tacatgcgggcccgaagcaacgttgagggctttgagagactcatctgtaaccagaagaaa
gagaatgagaccagggtggtgctgtgtgagctgggcaatcccatgaagaagaacacccag
ataggaattgcgatgttggtgagcgtggggaatctggaagaggctggggagtctgtgtcc
ttccagctgcagatccggagcaagaacagccagaatccaaacagcaagattgtgctgctg
gatgtgccagtccgggcagaggcccaagtggagctgcgagggaactcctttccagcctcc
ctggtggtggctgcagaagaaggtgacagggagcagaacagcttggacagccggggaccc
aaagtggagcacacctatgagctccacaacaatggccctgggactgtgaatggccttcac
ctcagcatccacctcccggggcagtcccagcactctgacctgctctacatcctggatata
cagccccaggggggccttcagtgcttcccacagcctcctgtcaaccccctcaaggtggac
tgggggctgcccacccccagcccctcccccgttcacccggcccaccacaagcgggatcgc
agacagatcttcctgccagagcccgagcagccctcgaggcttcaggatccagttctcgta
agctgcgactcggcgccctgtactgtggtgcagtgtgacctgcaggagatggcgcgcggg
cagcgggccatggtcacggtgctggctttcctgtggctgcccagcctccaccagaggcca
ctggatcagtttgtgctgcagtcacaggcatggttcaacgtgtcctccctcccctatgcc
gtgcccccgctcagcctgccacgaggggaagctcaggtgcggacacagctgcttcgggcc
ttggaggagagggccattccaatctggtgggtgctggtgggtgtgctgggcggcctgctg
ctgctcaccatcctggtcctggccatgtggaaggtcggcttcttcaagcggaaccggcca
cccctggaagaagatgatgaagagggggagtga

DBGET integrated database retrieval system