KEGG   Macaca mulatta (rhesus monkey): 100428640
Entry
100428640         CDS       T01028                                 

Gene name
THPO
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombopoietin
  KO
K06854  thrombopoietin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100428640 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100428640 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100428640 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    100428640 (THPO)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   100428640 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100428640
NCBI-ProteinID: XP_014986917
LinkDB
Position
2
AA seq 520 aa
MSCQIPPGKKPLLLSPSRSQVAHVQEKMNLPIQVFSMVCVGGGVDPGPGRGSREEKASLP
GAFASVWWFPPLIGQKWPRQACDLLLWRGCAPPPHVFLPICSPEGCLLCTWVLEPFSTRI
DSSSLARLXPTLLCPEVQEPKPPPWPQEGFRGEAPNREPRQPDTPARMELTELLLVVMLL
LTARLTLSSPAPPACDPRVLSKLLRDSRVLHSRLSLCPEVNPLPTPVLLPAVDFSLGEWK
TQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQL
PPQGRTTAHKDPNAIFLSFQHLLRGKVRFLLLVGGPTLCVRRAPPTTAVPSRTSLVLTLN
ELPNRTSGLLETNFTASARTTGSGLQKRQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHKL
LNGTRGLFPGPSRRTLGAPDISPGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTL
PSPVVQLHPLLPDPSAPTPTPTSPLLNTSHTHSQNLSQEG
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgtcctgccagattcctcctggaaaaaaacctctgctcctgtccccctccaggtcccag
gttgcccatgtccaggaaaagatgaatctccctatccaagtcttctccatggtgtgtgtg
ggtggaggagtggaccctggtccaggcaggggctccagggaagagaaggcgtcacttccg
ggggccttcgccagtgtctggtggttccctcctctgattgggcagaagtggcccaggcag
gcgtgtgacctgctgctgtggaggggctgtgccccaccgccacatgtcttcctacccatc
tgctccccagagggctgcctgctgtgcacttgggtcctggagcccttctccacccggata
gattcctcatccttggcccgcctttgacccaccctactctgcccagaagtgcaagagccc
aagccgcctccatggccccaggaaggattcaggggagaggccccaaacagggagccacgc
cagccagacaccccggccagaatggagctgactgaattgctcctcgtggtcatgcttctc
ctaactgcaaggctaactctgtccagcccggctcctcctgcctgtgacccccgagtcctc
agtaaactgcttcgtgactcccgtgtccttcacagcagactgagcctgtgcccagaggtt
aaccctttacccacacctgtcctgctgcctgctgtggactttagcttgggagaatggaaa
acccagatggaggagaccaaggcacaggacattctgggagcagtgacccttctgctggag
ggagtgatggcagcacggggacaactgggacccacttgcctctcatcccttctggggcag
ctttctggacaggtccgtctcctcctcggggccctgcagagcctccttggaacccagctt
cctccacagggcaggaccacagctcacaaggatcccaatgccatcttcctgagcttccaa
cacctgctccgaggaaaggtgcgtttcctgctgcttgtaggagggcccaccctctgcgtc
aggcgggccccacccaccacagctgtccccagcagaacctctctagtcctcacactgaac
gagctcccaaacaggacttctggattgttggagacaaacttcactgcctcggccagaact
actggctctggacttcagaagcggcagcagggattcagagccaagattcctggtctgctg
aaccaaacctccaggtccctggaccaaatccccggatacctgaacaggatacacaaactc
ttgaatggaactcgtggactctttcctggaccctcacgcaggaccctaggagccccggac
atttccccaggaacatcagacacaggctccctgccacccaacctccagcctggatattct
ccttccccaacccatccccctactggacagtacacactcttccctcttccacccaccttg
ccctcccctgtggtccagctccaccccctgcttcctgacccttctgctccaacacccacc
cctaccagccctcttctaaacacatcccacacccactcccagaatctgtctcaggaaggg
taa

KEGG   Macaca mulatta (rhesus monkey): 114669732
Entry
114669732         CDS       T01028                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114669732
   04151 PI3K-Akt signaling pathway
    114669732
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114669732
   04060 Cytokine-cytokine receptor interaction
    114669732
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    114669732
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114669732
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   114669732
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 114669732
NCBI-ProteinID: XP_028692488
LinkDB
Position
16
AA seq 217 aa
MAAGSQTSLLLAFALLCLPWLQEAGRVPSVPLSRLFDNAMIHAYRLHRLAFDTYQEFEEA
YIPKQQKYSFLRNPQTSLCFSESIPTPSNMEETQQKSNLELLHISLLLIQSWLEPVQFLR
SVFANRLVYGTSDSDVYDLLKSLEEGIQTLMGRLEDGSPRTGQIFKQTYSTFDTNSHNDD
TLLKNYWLLHCFRKDMNKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccagacgtccctgctcctggcttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtcccaagcgtacccttatccaggctttttgacaacgctatg
atccacgcctatcgcctgcaccggctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaagcaacagaagtattcattcctgcggaacccccagacctccctctgcttc
tcagagtctattcccacaccctccaacatggaggaaacacaacagaaatccaacctagag
ctgctccacatctccctactgctcatccagtcctggctggagcccgtgcagttcctcagg
agtgtgtttgccaacaggctggtgtatggcacctcagacagcgacgtctatgacctccta
aaaagcctagaggaaggcatccaaacgctgatggggaggctggaagatggtagcccccgg
actgggcagatcttcaagcagacctacagcacgtttgacacaaactcgcacaatgatgac
acactgctcaagaactactggctgctccactgtttcaggaaggacatgaacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 114669819
Entry
114669819         CDS       T01028                                 

Definition
(RefSeq) somatotropin-like isoform X1
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114669819
   04151 PI3K-Akt signaling pathway
    114669819
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114669819
   04060 Cytokine-cytokine receptor interaction
    114669819
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    114669819
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114669819
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   114669819
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 114669819
NCBI-ProteinID: XP_028692489
LinkDB
Position
16
AA seq 248 aa
MAAGSRTSLLLVFALLCLPWLQEAGRVSSVPLSRLFDNIMIQAHRLHQLAFDTYQEFEKT
YIPKEKKHSLMGNPQASFCFSESIPTPSNREETQQKSVSGYLLPKVGIGEACGQSPRAAQ
PLRVLPLQNLELLRISLLLIQSWLEPVQLLGSVFANNLVYGTSESDAYDLLKNLEEGIQT
LMRRLQDGSPRTGQIFKQTYSTFDTDSQNDDSLLKNYELLHCFRKDMDMVETFLRMVQCR
TVEGSCGF
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggtttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtctcaagcgtacccttatccaggctttttgacaacattatg
atccaagcccatcgcctgcaccaactggcctttgacacctaccaggagtttgaaaaaacc
tacatcccaaaggaaaagaagcattcgctcatggggaacccccaggcctccttctgcttc
tcagagtctattcccacaccctccaacagggaggaaacgcagcagaaatccgtgagtgga
taccttctccccaaggtggggataggggaggcctgtggtcagagcccccgggcagcacag
ccactgcgtgtccttcccctgcagaacctagagctgctccgcatctccctgcttctcatc
cagtcgtggctggagcccgtgcagttactcgggagtgtgtttgccaacaacctggtgtat
ggcacctcggagagcgatgcctatgacctcctaaagaacctagaggaaggcatccaaacg
ttgatgcggaggctgcaagatggcagcccccggactgggcagatcttcaagcagacctac
agcacgtttgacacagactcacagaacgatgactcactgctcaagaactacgagctgctc
cactgcttcaggaaggacatggatatggtcgagacattcctgcgcatggtgcagtgccgc
actgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 114673168
Entry
114673168         CDS       T01028                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114673168
   04151 PI3K-Akt signaling pathway
    114673168
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114673168
   04060 Cytokine-cytokine receptor interaction
    114673168
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    114673168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114673168
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   114673168
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 114673168
NCBI-ProteinID: XP_028692493
LinkDB
Position
16
AA seq 223 aa
MAAGSRTSLLLVFALLCLPWLQEAGRVSSVPLSRLFDNIMIQAHRLHQLAFDTYQEFVSS
WGMGKTYIPKEKKHSLMGNPQASFCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLE
PVQLLGSVFANNLVYGTSESDAYDLLKNLEEGIQTLMRRLQDGSPRTGQIFKQTYSTFDT
DSQNDDSLLKNYELLHCFRKDMDMVETFLRMVQCRTVEGSCGF
NT seq 672 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggtttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtctcaagcgtacccttatccaggctttttgacaacattatg
atccaagcccatcgcctgcaccaactggcctttgacacctaccaggagtttgtaagctct
tggggaatgggaaaaacctacatcccaaaggaaaagaagcattcgctcatggggaacccc
caggcctccttctgcttctcagagtctattcccacaccctccaacagggaggaaacgcag
cagaaatccaacctagagctgctccgcatctccctgcttctcatccagtcgtggctggag
cccgtgcagttactcgggagtgtgtttgccaacaacctggtgtatggcacctcggagagc
gatgcctatgacctcctaaagaacctagaggaaggcatccaaacgttgatgcggaggctg
caagatggcagcccccggactgggcagatcttcaagcagacctacagcacgtttgacaca
gactcacagaacgatgactcactgctcaagaactacgagctgctccactgcttcaggaag
gacatggatatggtcgagacattcctgcgcatggtgcagtgccgcactgtggagggcagc
tgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 114673169
Entry
114673169         CDS       T01028                                 

Definition
(RefSeq) somatotropin-like
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    114673169
   04151 PI3K-Akt signaling pathway
    114673169
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    114673169
   04060 Cytokine-cytokine receptor interaction
    114673169
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    114673169
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    114673169
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   114673169
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 114673169
NCBI-ProteinID: XP_028692494
LinkDB
Position
16
AA seq 225 aa
MAAGSRTSLLLVFALLCLPWLQEAGRVSSVPLSRLFDNIMIQAHRLHQLAFDTYQEFCKL
LGNGCEKTYIPKEKKHSLMGNPQASFCFSESIPTPSNREETQQKSNLELLRISLLLIQSW
LEPVQLLGSVFANNLVYGTSESDAYDLLKNLEEGIQTLMRRLQDGSPRTGQIFKQTYSTF
DTDSQNDDSLLKNYELLHCFRKDMDMVETFLRMVQCRTVEGSCGF
NT seq 678 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggtttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtctcaagcgtacccttatccaggctttttgacaacattatg
atccaagcccatcgcctgcaccaactggcctttgacacctaccaggagttttgtaagctc
ttggggaatgggtgcgaaaaaacctacatcccaaaggaaaagaagcattcgctcatgggg
aacccccaggcctccttctgcttctcagagtctattcccacaccctccaacagggaggaa
acgcagcagaaatccaacctagagctgctccgcatctccctgcttctcatccagtcgtgg
ctggagcccgtgcagttactcgggagtgtgtttgccaacaacctggtgtatggcacctcg
gagagcgatgcctatgacctcctaaagaacctagaggaaggcatccaaacgttgatgcgg
aggctgcaagatggcagcccccggactgggcagatcttcaagcagacctacagcacgttt
gacacagactcacagaacgatgactcactgctcaagaactacgagctgctccactgcttc
aggaaggacatggatatggtcgagacattcctgcgcatggtgcagtgccgcactgtggag
ggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 698728
Entry
698728            CDS       T01028                                 

Gene name
LEP
Definition
(RefSeq) leptin precursor
  KO
K05424  leptin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04152  AMPK signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04920  Adipocytokine signaling pathway
mcc04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    698728 (LEP)
   04152 AMPK signaling pathway
    698728 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    698728 (LEP)
   04060 Cytokine-cytokine receptor interaction
    698728 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    698728 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    698728 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    698728 (LEP)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   698728 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 698728
NCBI-ProteinID: NP_001036220
Ensembl: ENSMMUG00000005322
UniProt: Q28504
LinkDB
Position
3
AA seq 167 aa
MYWRTLWGFLWLWPYLFYIQAVPIQKVQSDTKTLIKTIVTRINDISHTQSVSSKQRVTGL
DFIPGLHPVLTLSQMDQTLAIYQQILINLPSRNVIQISNDLENLRDLLHLLAFSKSCHLP
LASGLETLESLGDVLEASLYSTEVVALSRLQGSLQDMLWQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtattggagaaccctgtggggattcttgtggctttggccctatctgttctacatccaa
gctgtgcccatccaaaaagtccaaagtgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcggtctcctccaaacagagggtcactggtttg
gacttcattcctgggctccaccccgtcctgaccttatcccagatggaccagacactggca
atctaccaacagatcctcatcaatctgccttccagaaacgtgatccaaatatccaacgac
ttggagaatctccgggaccttcttcacctgctggccttctctaagagctgccatttgccc
ttggccagtggcctggagaccttggagagcctgggggatgtcctggaagcttcactctac
tccacggaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

KEGG   Macaca mulatta (rhesus monkey): 698961
Entry
698961            CDS       T01028                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor
  KO
K05423  granulocyte colony-stimulating factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc04657  IL-17 signaling pathway
mcc05144  Malaria
mcc05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    698961 (CSF3)
   04151 PI3K-Akt signaling pathway
    698961 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    698961 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    698961 (CSF3)
   04657 IL-17 signaling pathway
    698961 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    698961 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    698961 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    698961 (CSF3)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   698961 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 Img2 NAGLU
Other DBs
NCBI-GeneID: 698961
NCBI-ProteinID: XP_001095097
Ensembl: ENSMMUG00000002923
LinkDB
Position
16
AA seq 200 aa
MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEK
LCATYKLCHPEELVLLRHSLGIPWAPLSSCPSQALQLTGCLSQLHSSLFLYQGLLQALEG
ISPELGPTLDTLQLDIADFATTIWQQMEDLGMAPALQPTQGAMPAFTSAFQRRAGGVLVA
SHLQRFLELAYRVLRHLAQS
NT seq 603 nt   +upstreamnt  +downstreamnt
atgtctcctgagcctgctctgtccccagccctgcagctgctgctgtggcacagcgcactc
tggacagtgcaggaagccacccccctgggccctgccagctccctgccccagagcttcctg
ctcaagtgcttagagcaagtaaggaagatccagggcgacggtgccgcgctgcaggagaag
ttgtgtgccacctacaagctgtgccaccctgaggagctggtgctgcttagacactctctg
ggcatcccctgggctcccctgagcagctgccccagccaggccctgcagctgacaggctgc
ttgagccaactccatagcagcctcttcctctaccagggcctcctgcaggccctggaaggg
atctcccctgagttgggccccaccttggatacactgcagctggacattgccgactttgcc
accaccatctggcagcagatggaagacctgggaatggcccctgccctgcagcccacccag
ggtgccatgccagccttcacctctgccttccagcgccgggcgggaggcgtcctggttgcc
tcccatctgcagcgcttcctggagctagcgtaccgcgttctacgccaccttgcccagtcc
tga

KEGG   Macaca mulatta (rhesus monkey): 700885
Entry
700885            CDS       T01028                                 

Gene name
GHV
Definition
(RefSeq) growth hormone variant precursor
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    700885 (GHV)
   04151 PI3K-Akt signaling pathway
    700885 (GHV)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    700885 (GHV)
   04060 Cytokine-cytokine receptor interaction
    700885 (GHV)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    700885 (GHV)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    700885 (GHV)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   700885 (GHV)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 700885
NCBI-ProteinID: NP_001036204
UniProt: Q07370 A0A5F7ZB15
LinkDB
Position
16
AA seq 217 aa
MAAGSWTCLILAIALLCLPWLQEGSAFPTIPLSWLFNTAVFRAHHLHKLAFDTYPKFEEA
YIPKEQKYSFLRNPQTSLCFSESIPTPSNKEETQQKSNLELLHISLLLIQSWLEPVQFLR
SVFANHLVHTNSNFDIYLYLKKLEEGIQTLMGRLEDGSPRTGQIFKETYSKYDTNSHNDD
TLLKNYRLLYCFRKDMNKVETFLRTVRCRAVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcctggacatgcctaattctggctattgccctgctctgcctaccttgg
cttcaagagggcagtgccttcccaaccattcccttatcctggctttttaacaccgctgtg
ttccgcgcccatcacctgcacaagctggcatttgacacgtacccgaagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcgcaacccccagacctccctctgcttc
tcagagtctattccgacaccctccaacaaggaggaaacacagcagaaatccaacctagag
ctgctccacatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtgtttgccaaccacctggtgcataccaactcgaacttcgacatctatctctaccta
aagaaactagaggaaggcatccaaacgctgatggggaggctggaagacggcagcccccgg
actgggcagatcttcaaggagacctacagcaagtatgacacaaactcgcacaacgatgac
acactgctcaagaactacaggctgctctactgcttcaggaaggacatgaacaaggtcgag
acattcctgcgcaccgtgcggtgccgcgctgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 701907
Entry
701907            CDS       T01028                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    701907 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    701907 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    701907 (CNTF)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   701907 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 701907
NCBI-ProteinID: XP_001093229
Ensembl: ENSMMUG00000011714
LinkDB
Position
14
AA seq 200 aa
MAFAEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNENINLDSVDGVPVAS
TDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTKGDFHQAIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPFSFGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQTGIPARGSHYIANNKNV
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcgcagagcattcaccgctgacccctcaccgtcgggacctctgtagccgctct
atctggctagcaaggaagattcgttcagacctgactgctcttacggaatcttatgtgaag
catcagggcctgaacgagaacatcaacctggattctgtggatggggtgccagtggcaagc
actgatcagtggagtgagctgaccgaggcagagcgactccaagagaaccttcaagcttat
cgtaccttccatgttttgttggccaggcttttagaagaccagcaggtgcattttacccca
accaaaggtgacttccatcaagctatacatacccttcttctccaagttgctgcctttgca
taccagatagaggagttaatgatactcctggaatacaagattccccgcaatgaggctgat
gggatgccttttagttttggagatggtggtctctttgagaagaagctgtggggcctaaag
gtgctgcaggagctttcacagtggacagtgaggtccatccatgaccttcgtgtcatttct
tctcatcagactgggatcccagcacgtgggagccattatattgctaacaacaagaatgtg
tag

KEGG   Macaca mulatta (rhesus monkey): 707052
Entry
707052            CDS       T01028                                 

Gene name
PRL
Definition
(RefSeq) prolactin precursor
  KO
K05439  prolactin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    707052 (PRL)
   04151 PI3K-Akt signaling pathway
    707052 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    707052 (PRL)
   04060 Cytokine-cytokine receptor interaction
    707052 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    707052 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    707052 (PRL)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   707052 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 707052
NCBI-ProteinID: NP_001040593
Ensembl: ENSMMUG00000020646
UniProt: P55151
LinkDB
Position
4
AA seq 227 aa
MNIKGSPWKGSLLLLLVSNLLLCQNVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITRAINSCHTSSLPTPEDKEQAQQMNQKDFLSLIVSILRSWN
EPLYHLVTEVRGMEEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWTG
LPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtgtcaaacctg
ctcctgtgccagaacgtggcccccttgcccatctgtcctggtggggctgccagatgccag
gtgacccttcgagacctgtttgaccgcgcagttgtcctgtcccactacatccataacctc
tcctcagaaatgttcagcgaattcgataaacggtatacccatggccgggggttcattacc
agggccatcaacagctgccacacttcttcccttcccacccccgaagacaaggagcaagcc
caacagatgaatcaaaaagactttctgagcctgatagtcagcatattgcgatcctggaat
gagcccctgtatcatctagtcacagaagtacgtggtatggaagaagccccggaggctatc
ctatccaaagccgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg
atagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggacggga
cttccatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctgctc
cactgcctacgcagggattcacataagatcgacaattatctcaagctcctgaagtgccga
atcatccacaacaacaactgctaa

KEGG   Macaca mulatta (rhesus monkey): 717562
Entry
717562            CDS       T01028                                 

Gene name
CSH2
Definition
(RefSeq) chorionic somatomammotropin hormone 2 precursor
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    717562 (CSH2)
   04151 PI3K-Akt signaling pathway
    717562 (CSH2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    717562 (CSH2)
   04060 Cytokine-cytokine receptor interaction
    717562 (CSH2)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    717562 (CSH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    717562 (CSH2)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   717562 (CSH2)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 717562
NCBI-ProteinID: NP_001036205
UniProt: Q07369
LinkDB
AA seq 217 aa
MAAGSRTSLLLVFALLCLPWLQEAGRVPSVPLSRLFDNIMMQAHRLHQLAFDTYQEFEKT
YIPKEKKHSLMGNPQASFCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQLLG
SVFANNLVYGTSESDAYDLLKNLEEGIQTLMRRLQDGSPRTGQIFKQTYSTFDTDSQNDD
SLLKNYELLHCFRKDMDMVETFLRMVQCRTVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggtttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtcccaagcgtacccttatccaggctttttgacaacattatg
atgcaagcccatcgcctgcaccaactggcctttgacacctaccaggagtttgaaaaaacc
tacatcccaaaggaaaagaagcattcgctcatggggaacccccaggcctccttctgcttc
tcagagtctattcccacaccctccaacagggaggaaacgcagcagaaatccaacctagag
ctgctccgcatctccctgcttctcatccagtcgtggctggagcccgtgcagttactcggg
agtgtgtttgccaacaacctggtgtatggcacctcggagagcgatgcctatgacctccta
aagaacctagaggaaggcatccaaacgttgatgcggaggctgcaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcacgtttgacacagactcacagaacgatgac
tcactgctcaagaactacgagctgctccactgcttcaggaaggacatggatatggtcgag
acattcctgcgcatggtgcagtgccgcactgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 718116
Entry
718116            CDS       T01028                                 

Gene name
CSH4
Definition
(RefSeq) somatotropin precursor
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    718116 (CSH4)
   04151 PI3K-Akt signaling pathway
    718116 (CSH4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    718116 (CSH4)
   04060 Cytokine-cytokine receptor interaction
    718116 (CSH4)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    718116 (CSH4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    718116 (CSH4)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   718116 (CSH4)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 718116
NCBI-ProteinID: NP_001040620
Ensembl: ENSMMUG00000000578
UniProt: Q1L7U5
LinkDB
Position
16
AA seq 217 aa
MAAGSQTSLLLAFALLCLPWLQEAGRVPSVPLSRLFDNAMIHAYRLHRLAFDTYQEFEEA
YIPKQQKYSFLRKPQTPLWLSESIPTPSNMEETQQKSNLELLHISLLLIQSWLEPVQFLR
SVFANRLVYGTSDSDVYDLLKSLEEGIQTLMGRLEDGSPRTGQIFKQTYSTFDTNSHNDD
TLLKNYWLLHCFRKDMDKVETFLRMVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccagacgtccctgctcctggcttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtcccaagcgtacccttatccaggctttttgacaacgctatg
atccacgcctatcgcctgcaccggctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaagcaacagaagtattcattcctgcggaaaccccagactcctctctggctc
tcagagtctattcccacaccctccaacatggaggaaacacaacagaaatccaacctagag
ctgctccacatctccctactgctcatccagtcctggctggagcccgtgcagttcctcagg
agtgtgtttgccaacaggctggtgtatggcacctcagacagcgacgtctatgacctccta
aaaagcctagaggaaggcatccaaacgctgatggggaggctggaagatggtagcccccgg
actgggcagatcttcaagcagacctacagcacgtttgacacaaactcgcacaatgatgac
acactgctcaagaactactggctgctccactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatggtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 718135
Entry
718135            CDS       T01028                                 

Gene name
CSH3
Definition
(RefSeq) chorionic somatommamotropin hormone 3 precursor
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    718135 (CSH3)
   04151 PI3K-Akt signaling pathway
    718135 (CSH3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    718135 (CSH3)
   04060 Cytokine-cytokine receptor interaction
    718135 (CSH3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    718135 (CSH3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    718135 (CSH3)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   718135 (CSH3)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 718135
NCBI-ProteinID: NP_001040618
Ensembl: ENSMMUG00000023706
UniProt: Q1L7U6
LinkDB
Position
16
AA seq 217 aa
MAAGSRTSQILAFALLCRPWLQEAGAVQSVPLSRFFDNAMLHAHRLHQLAFDTYQKFEEA
YIPKENKYSFLQNPQTSLCFSESIPTPSNMEERQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANRLVCGTSDSDVYDLLKSLEEGIQTLMGRLEDGSPRTGQIFKATYIKFDTNSHNND
ALLENYRLLHCFRRNMDKVETFLRMAQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacctcccagatcctggcttttgccctgctctgccggccatgg
cttcaagaggccggtgccgtccaatccgttcccttatccaggttttttgacaacgctatg
ctccacgcccatcgcctgcaccagctggcctttgacacctaccagaagtttgaagaagcc
tatatcccaaaggaaaataagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattcccacaccctccaacatggaggaaaggcagcagaaatctaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtgtttgccaacaggctagtgtgtggcacctcggacagcgacgtctatgacctccta
aaaagcctagaggaaggcatccaaacgctgatggggaggctggaagatggcagccccagg
actgggcagatcttcaaggcgacctacatcaagtttgacacaaactcacacaacaatgat
gcactgctcgagaactacaggctgctccactgcttcaggaggaacatggataaggtcgag
acattcctgcgcatggcgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 718156
Entry
718156            CDS       T01028                                 

Gene name
GH1
Definition
(RefSeq) somatotropin precursor
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    718156 (GH1)
   04151 PI3K-Akt signaling pathway
    718156 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    718156 (GH1)
   04060 Cytokine-cytokine receptor interaction
    718156 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    718156 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    718156 (GH1)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   718156 (GH1)
SSDB
Motif
Pfam: Hormone_1 XTBD
Other DBs
NCBI-GeneID: 718156
NCBI-ProteinID: NP_001036203
Ensembl: ENSMMUG00000039847
UniProt: P33093 Q1L7V0
LinkDB
Position
16
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGTSYSDVYDLLKDLEEGIQTLMGRLEDGSSRTGQIFKQTYSKFDTNSHNND
ALLKNYGLLYCFRKDMDKIETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgcctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccgacaccctccaacagggaggaaacacagcagaaatccaacctagag
ctgctccgcatctccctgcttctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtgtttgccaacagcctggtgtatggcacctcgtacagtgacgtctatgacctctta
aaggacctagaggaaggcatccaaacactgatggggaggctggaagatggcagctcccgg
actggacagatcttcaagcagacctacagcaagtttgacacaaactcacacaacaatgat
gcactgctcaagaactacgggctgctctattgcttcaggaaggacatggacaagatcgag
acattcctgcgcattgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 718474
Entry
718474            CDS       T01028                                 

Definition
(RefSeq) growth hormone variant-like isoform X1
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    718474
   04151 PI3K-Akt signaling pathway
    718474
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    718474
   04060 Cytokine-cytokine receptor interaction
    718474
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    718474
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    718474
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   718474
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 718474
NCBI-ProteinID: XP_028692491
LinkDB
Position
16
AA seq 248 aa
MAAGSWTCLILAIALLCLPWLQEGSAFPTIPLSWLFNTAVLRAHHLHKLASDTYPKFEEA
YIPKEQKYSFLRNPQTSLCFSESIPTPSNKEETQQKSVSGCLLPQAGMGEACGQSPRAAQ
QPLVLPLQNLELLHISLLLIQSWLEPVQCLRSVFTNNLVYGTSNFNVYLYLKNLEEGIQT
LMGRLEDGSPRTGQIFKQTYSKFDTNSHNDDTLLKNYRLLYCFRKDMNKVETFLRTVRCR
AVEGSCGF
NT seq 747 nt   +upstreamnt  +downstreamnt
atggctgcaggctcctggacatgcctaattctggctattgccctgctctgcctaccttgg
cttcaagagggcagtgccttcccaaccattcccttatcctggctttttaacaccgctgtg
ctccgcgcccatcacctgcacaagctggcatctgacacgtacccgaagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcgcaacccccagacctctctctgcttc
tcagagtctattccgacaccctccaacaaggaggaaacacagcagaaatccgtgagtgga
tgccttctcccccaggcagggatgggggaggcctgtggtcagagcccccgggcagcacag
caaccgctggtccttcctctgcagaacctagagctgctccacatctccctgctgctcatc
cagtcgtggctggagcccgtgcagtgcctcaggagtgtgtttaccaacaacctggtgtat
ggcacctcgaacttcaacgtctatctctacctaaagaacctagaggaaggcatccaaacg
ctgatggggaggctggaagacggcagcccccggactgggcagatcttcaagcagacctac
agcaagtttgacacaaactcgcacaacgatgacacactgctcaagaactacaggctgctc
tactgcttcaggaaggacatgaacaaggtcgagacattcctgcgcaccgtgcggtgccgc
gctgtggagggcagctgtggcttctag

KEGG   Macaca mulatta (rhesus monkey): 719294
Entry
719294            CDS       T01028                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin precursor
  KO
K05437  erythropoietin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04066  HIF-1 signaling pathway
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04640  Hematopoietic cell lineage
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    719294 (EPO)
   04066 HIF-1 signaling pathway
    719294 (EPO)
   04151 PI3K-Akt signaling pathway
    719294 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    719294 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    719294 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    719294 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    719294 (EPO)
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   719294 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 719294
NCBI-ProteinID: NP_001036201
Ensembl: ENSMMUG00000022863
UniProt: Q28513
LinkDB
Position
3
AA seq 192 aa
MGVHECPAWLWLLLSLVSLPLGLPVPGAPPRLVCDSRVLERYLLEAKEAENVTMGCSESC
SLNENITVPDTKVNFYAWKRIEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQL
HMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLK
LYTGEACRRGDR
NT seq 579 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctgtctctcgtgtcgctccct
ctgggcctcccagtcccgggcgccccaccacgcctcgtctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatgtcacgatgggctgttccgaaagctgc
agcttgaatgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg
atagaggtcgggcagcaggctgtagaagtctggcagggcctggccctgctctcagaagct
gtcctgcggggccaggccgtgttggccaactcttcccagcctttcgagcccctgcagctg
cacatggataaagccatcagtggccttcgcagcatcaccactctgcttcgggcgctggga
gcccaggaagccatctccctcccagatgcggcctcggctgctccactccgaaccatcact
gctgacactttctgcaaactcttccgagtctactccaatttcctccggggaaagctgaag
ctgtacacgggggaggcctgcaggagaggggacagatga

KEGG   Macaca mulatta (rhesus monkey): 735307
Entry
735307            CDS       T01028                                 

Definition
(RefSeq) chorionic somatomammotropin-1 precursor
  KO
K05438  growth hormone
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04060  Cytokine-cytokine receptor interaction
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04630  JAK-STAT signaling pathway
mcc04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    735307
   04151 PI3K-Akt signaling pathway
    735307
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    735307
   04060 Cytokine-cytokine receptor interaction
    735307
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    735307
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mcc04052]
    735307
Cytokines and growth factors [BR:mcc04052]
 Cytokines
  CSF and other factors
   735307
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 735307
NCBI-ProteinID: NP_001036207
Ensembl: ENSMMUG00000011358
UniProt: Q07367
LinkDB
Position
16
AA seq 217 aa
MAAGSRTSLLLVFALLCLPWLQEAGRVPSVPLSRLFDHAMIQAHRLHQLAFDTYQEFEEA
YIPKEKKHSLMENPQASFCFADSIPTPSNLEETQQKSNLELLRISLLLIQSWLEPVQFLS
SVFANNLLHHTSDSDVHDLLKDLEEGIETLMWRLEDGIPRTGHIFKQTYSKFDAHSQNDD
SLLKNYGLLHCFRKDMDMVETFLRMVQCRTVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacatccctgctcctggtttttgccctcctctgcctgccttgg
cttcaagaggctggtagggtcccaagcgtacccttatccagactttttgaccatgctatg
atccaagcccatcgcctgcaccaactggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaaaagaagcattcgctcatggagaacccccaggcctccttctgcttc
gcagactctattcccacaccctccaacttggaggaaacgcagcagaaatccaacctagag
ctgctccgcatctccctgctgctcatccagtcgtggctggagcccgtgcagttcctcagt
agtgtgtttgccaacaacctgttgcatcacacctcggacagcgacgtccatgacctccta
aaggacctagaggaaggcatcgaaacgttgatgtggaggctggaagatggcatcccccgg
actgggcacatcttcaagcagacctacagcaagtttgacgcacactcacagaacgatgac
tcactgctcaagaactacgggctgctccactgcttcaggaaggacatggatatggtcgag
acattcctgcgcatggtgcagtgccgcactgtggagggcagctgtggcttctag

DBGET integrated database retrieval system