KEGG   Macaca mulatta (rhesus monkey): 100428661Help
Entry
100428661         CDS       T01028                                 

Gene name
ACE, DCP1
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04614  Renin-angiotensin system
mcc04924  Renin secretion
mcc05142  Chagas disease (American trypanosomiasis)
mcc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100428661 (ACE)
   04614 Renin-angiotensin system
    100428661 (ACE)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100428661 (ACE)
  09174 Infectious diseases: Parasitic
   05142 Chagas disease (American trypanosomiasis)
    100428661 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    100428661 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100428661 (ACE)
   04090 CD molecules [BR:mcc04090]
    100428661 (ACE)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100428661 (ACE)
Peptidases [BR:mcc01002]
 Metallo Peptidases
  Family M2
   100428661 (ACE)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100428661 (ACE)
CD molecules [BR:mcc04090]
 Proteins
  100428661 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100428661
NCBI-ProteinID: XP_014975565
Ensembl: ENSMMUG00000012608
UniProt: A0A1D5R9B8
LinkDB All DBs
Position
16
AA seq 1307 aa AA seqDB search
MGAASGRQGPGPLLQPLLLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQ
VLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPELRK
IIGAVGTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASS
RSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDD
LEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVP
FPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVC
HASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEA
IGDVLALSVSTPAHLHKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVF
NGRTPPSHYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQ
FHEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGSDALDAQPL
LNYFQPVTQWLQEQNRQNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEASKFVEEYDRT
SQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNHFQNTTIKR
IIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLTNVMATSRK
YEELLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLE
RLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFP
SAPSMDPTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHA
SAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIG
DVLALSVSTPKHLHSLNLLSSEGGSHEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDG
SITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHVPSSVPYIRYFISFIIQFQFH
EALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLS
YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQ
WLLLFLGIALLVATLGLSQRLFSIRHQSLHQHPQGPQFGSEVELRHS
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccaggggccggggccgctgctgcagccgctgctactgctg
ctgttgctaccgccgcagcccgcgctggccctggaccccgggctgcagcccggcaacttt
tccgccgacgaggccggggcgcaactcttcgcgcagagctacaattcgagcgccgaacag
gtgctgttccagagcgtggccgccagctgggctcatgacaccaacatcaccgccgagaat
gcacggcgccaggaggaagcagccctgctcagccaggagtttgccgaggcctggggccag
aaggccaaggagctgtatgaaccgatctggcagaacttcacggacccggagctgcgcaag
atcatcggagctgtgggcaccctgggctctgccaacctgcccctggctaagcggcagcag
tacaatgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctcccc
aacaagactgccacctgctggtccctggacccagacctcaccaacatcctggcttcctca
cgaagctacgccatgctcctgtttgcctgggagggctggcacaacgccgcgggcatcccg
ctgaaaccgctgtacgaggacttcactgccctcagcaatgaagcctacaagcaggacggc
ttcacagacacgggggcctactggcgctcctggtacaactcccccacttttgaggacgat
ctggagcacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgc
cgtgcactgcatcgccgatatggggacagatacatcaacctcaggggacccatccctgct
catctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcct
ttcccagacaagcccaacctcgacgtcaccagtactatgctgcagcagggctggaatgcc
acgcacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcct
cccgagttctgggaagggtcgatgctggagaagccggccgacgggcgggaggtggtgtgc
cacgcctcggcttgggacttctacaacaggaaagacttcaggatcaagcaatgcacacgg
gtcacgatggaccagctctctacagtgcaccatgagatgggccatatacagtactacctg
cagtacaaggacctgcccgtctctctgcgcgggggggccaaccccggcttccatgaggcc
attggggacgtgctggcactctcagtctctactcctgcacatctgcacaaaatcggcctg
ctggaccatgtcaccaatgacacggaaagtgacatcaattacttgctaaagatggcactg
gaaaaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtcttt
aatgggcgtactcctccttcccactacaacttcgactggtggtatcttcgaaccaagtat
caggggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagttt
catgttccaaatgtgacaccatacatcaggtactttgtgagtttcgtcctgcagttccag
ttccatgaagccctgtgcaaggaggcaggctatgagggcccactgcaccaatgtgacatc
taccagtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccagg
ccctggcaggaggtgctgaaggacatggtcggctcagacgccctggacgcccagccactg
ctcaactacttccagccggtcacccagtggctgcaggagcagaaccggcagaacggcgag
gtcctgggctggcctgagtaccagtggcgcccaccgttgcctgacaactacccggagggc
atcgacctggtgaccgatgaggctgaggccagcaagttcgtggaggaatatgacaggaca
tcccaggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacattacc
acagagaccagcaagattctgctgcagaagaacatgcaaatagccaaccatactctgaag
tacggcacccaggccaggaggtttgatgtgaaccacttccagaacaccacgatcaagcgg
atcataaagaaggttcaggacctagaacgggcagcgctgcctgcccaggagctggaggag
tacaacaagatcctgttggacatggaaaccacctacagcgtggccactgtgtgccacacg
aatggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacgtcccggaaa
tatgaagaactgttgtgggcatgggagggctggcgagacaaggctgggagagccatcctc
cagttttacccaaaatacgtggaactgatcaaccaggctgcccggctcaatggctatgta
gatgccggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggag
cgcctcttccaggagctgcagccgctgtacctgaacctgcatgcctatgtgcgccgggcc
ctgcaccgccactacggggcccagcacatcaatctggaggggcccatccctgctcacctg
ctggggaacatgtgggcgcaaacttggtccaacatctatgacttggtggtgcccttccct
tcagccccctcgatggaccccacggaggccatgctaaagcagggctggacgccccggagg
atgtttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgag
ttctggaacaagtcgatgctggagaagccaactgacgggcgagaggtggtctgccacgcc
tcggcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaac
ttggaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtac
aaagacttgcctgtggccttgagggagggcgccaaccccggcttccatgaggccattggg
gacgtgctagccctctcagtgtctacgcccaagcacctgcacagtctgaacctgctgagc
agtgagggtggcagccatgagcatgatatcaactttctgatgaagatggcgcttgacaag
atcgcctttatccccttcagctatctcgttgatcagtggcgctggagggtgtttgatgga
agcatcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggc
ctctgccccccggtgcccaggactcaaggtgactttgacccaggggccaagttccacgtt
ccttctagcgtgccttacatcaggtacttcatcagcttcatcatccagttccagttccat
gaagcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccag
tccaaggaggcagggcagcgcctggcgacggccatgaagctgggcttcagtaggccgtgg
ccagaagccatgcagctgatcacgggccagcccaatatgagcgcctcggccatgctgagc
tacttcaagccgctgctagactggctccgcacggagaatgagctgcacggggagaagctg
ggctggccgcagtacaactggacaccgaactccgctcgctcagaagggcccctcccagac
agtggccgcgtcagcttcctgggcctggacctagatgcgcagcaggcccgcgtgggccag
tggctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcgg
ctcttcagcatccgccaccaaagcctccaccagcacccccaggggccccagttcggctcc
gaggtggagctgagacactcctga

DBGET integrated database retrieval system