KEGG   Macaca mulatta (rhesus monkey): 100428661Help
Entry
100428661         CDS       T01028                                 

Gene name
ACE, DCP1
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04614  Renin-angiotensin system
mcc04924  Renin secretion
mcc05142  Chagas disease (American trypanosomiasis)
mcc05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100428661 (ACE)
   04614 Renin-angiotensin system
    100428661 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100428661 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100428661 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mcc01002]
    100428661 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100428661 (ACE)
   04090 CD Molecules [BR:mcc04090]
    100428661 (ACE)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100428661 (ACE)
Peptidases [BR:mcc01002]
 Metallo Peptidases
  Family M2
   100428661 (ACE)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100428661 (ACE)
CD molecules [BR:mcc04090]
 Proteins
  100428661 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100428661
NCBI-ProteinID: XP_014975565
Ensembl: ENSMMUG00000012608
UniProt: A0A1D5R9B8
LinkDB All DBs
Position
16
AA seq 1307 aa AA seqDB search
MGAASGRQGPGPLLQPLLLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQ
VLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPELRK
IIGAVGTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASS
RSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDD
LEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVP
FPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVC
HASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEA
IGDVLALSVSTPAHLHKIGLLDHVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVF
NGRTPPSHYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQ
FHEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGSDALDAQPL
LNYFQPVTQWLQEQNRQNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEASKFVEEYDRT
SQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNHFQNTTIKR
IIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLTNVMATSRK
YEELLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLE
RLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFP
SAPSMDPTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHA
SAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIG
DVLALSVSTPKHLHSLNLLSSEGGSHEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDG
SITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHVPSSVPYIRYFISFIIQFQFH
EALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLS
YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQ
WLLLFLGIALLVATLGLSQRLFSIRHQSLHQHPQGPQFGSEVELRHS
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccaggggccggggccgctgctgcagccgctgctactgctg
ctgttgctaccgccgcagcccgcgctggccctggaccccgggctgcagcccggcaacttt
tccgccgacgaggccggggcgcaactcttcgcgcagagctacaattcgagcgccgaacag
gtgctgttccagagcgtggccgccagctgggctcatgacaccaacatcaccgccgagaat
gcacggcgccaggaggaagcagccctgctcagccaggagtttgccgaggcctggggccag
aaggccaaggagctgtatgaaccgatctggcagaacttcacggacccggagctgcgcaag
atcatcggagctgtgggcaccctgggctctgccaacctgcccctggctaagcggcagcag
tacaatgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctcccc
aacaagactgccacctgctggtccctggacccagacctcaccaacatcctggcttcctca
cgaagctacgccatgctcctgtttgcctgggagggctggcacaacgccgcgggcatcccg
ctgaaaccgctgtacgaggacttcactgccctcagcaatgaagcctacaagcaggacggc
ttcacagacacgggggcctactggcgctcctggtacaactcccccacttttgaggacgat
ctggagcacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgc
cgtgcactgcatcgccgatatggggacagatacatcaacctcaggggacccatccctgct
catctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcct
ttcccagacaagcccaacctcgacgtcaccagtactatgctgcagcagggctggaatgcc
acgcacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcct
cccgagttctgggaagggtcgatgctggagaagccggccgacgggcgggaggtggtgtgc
cacgcctcggcttgggacttctacaacaggaaagacttcaggatcaagcaatgcacacgg
gtcacgatggaccagctctctacagtgcaccatgagatgggccatatacagtactacctg
cagtacaaggacctgcccgtctctctgcgcgggggggccaaccccggcttccatgaggcc
attggggacgtgctggcactctcagtctctactcctgcacatctgcacaaaatcggcctg
ctggaccatgtcaccaatgacacggaaagtgacatcaattacttgctaaagatggcactg
gaaaaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtcttt
aatgggcgtactcctccttcccactacaacttcgactggtggtatcttcgaaccaagtat
caggggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagttt
catgttccaaatgtgacaccatacatcaggtactttgtgagtttcgtcctgcagttccag
ttccatgaagccctgtgcaaggaggcaggctatgagggcccactgcaccaatgtgacatc
taccagtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccagg
ccctggcaggaggtgctgaaggacatggtcggctcagacgccctggacgcccagccactg
ctcaactacttccagccggtcacccagtggctgcaggagcagaaccggcagaacggcgag
gtcctgggctggcctgagtaccagtggcgcccaccgttgcctgacaactacccggagggc
atcgacctggtgaccgatgaggctgaggccagcaagttcgtggaggaatatgacaggaca
tcccaggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacattacc
acagagaccagcaagattctgctgcagaagaacatgcaaatagccaaccatactctgaag
tacggcacccaggccaggaggtttgatgtgaaccacttccagaacaccacgatcaagcgg
atcataaagaaggttcaggacctagaacgggcagcgctgcctgcccaggagctggaggag
tacaacaagatcctgttggacatggaaaccacctacagcgtggccactgtgtgccacacg
aatggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacgtcccggaaa
tatgaagaactgttgtgggcatgggagggctggcgagacaaggctgggagagccatcctc
cagttttacccaaaatacgtggaactgatcaaccaggctgcccggctcaatggctatgta
gatgccggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggag
cgcctcttccaggagctgcagccgctgtacctgaacctgcatgcctatgtgcgccgggcc
ctgcaccgccactacggggcccagcacatcaatctggaggggcccatccctgctcacctg
ctggggaacatgtgggcgcaaacttggtccaacatctatgacttggtggtgcccttccct
tcagccccctcgatggaccccacggaggccatgctaaagcagggctggacgccccggagg
atgtttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgag
ttctggaacaagtcgatgctggagaagccaactgacgggcgagaggtggtctgccacgcc
tcggcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaac
ttggaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtac
aaagacttgcctgtggccttgagggagggcgccaaccccggcttccatgaggccattggg
gacgtgctagccctctcagtgtctacgcccaagcacctgcacagtctgaacctgctgagc
agtgagggtggcagccatgagcatgatatcaactttctgatgaagatggcgcttgacaag
atcgcctttatccccttcagctatctcgttgatcagtggcgctggagggtgtttgatgga
agcatcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggc
ctctgccccccggtgcccaggactcaaggtgactttgacccaggggccaagttccacgtt
ccttctagcgtgccttacatcaggtacttcatcagcttcatcatccagttccagttccat
gaagcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccag
tccaaggaggcagggcagcgcctggcgacggccatgaagctgggcttcagtaggccgtgg
ccagaagccatgcagctgatcacgggccagcccaatatgagcgcctcggccatgctgagc
tacttcaagccgctgctagactggctccgcacggagaatgagctgcacggggagaagctg
ggctggccgcagtacaactggacaccgaactccgctcgctcagaagggcccctcccagac
agtggccgcgtcagcttcctgggcctggacctagatgcgcagcaggcccgcgtgggccag
tggctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcgg
ctcttcagcatccgccaccaaagcctccaccagcacccccaggggccccagttcggctcc
gaggtggagctgagacactcctga

DBGET integrated database retrieval system