KEGG   Macaca mulatta (rhesus monkey): 100428682
Entry
100428682         CDS       T01028                                 

Gene name
PPP3R1
Definition
(RefSeq) calcineurin subunit B type 1 isoform X3
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100428682 (PPP3R1)
   04310 Wnt signaling pathway
    100428682 (PPP3R1)
   04370 VEGF signaling pathway
    100428682 (PPP3R1)
   04020 Calcium signaling pathway
    100428682 (PPP3R1)
   04022 cGMP-PKG signaling pathway
    100428682 (PPP3R1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100428682 (PPP3R1)
   04218 Cellular senescence
    100428682 (PPP3R1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100428682 (PPP3R1)
   04650 Natural killer cell mediated cytotoxicity
    100428682 (PPP3R1)
   04660 T cell receptor signaling pathway
    100428682 (PPP3R1)
   04658 Th1 and Th2 cell differentiation
    100428682 (PPP3R1)
   04659 Th17 cell differentiation
    100428682 (PPP3R1)
   04662 B cell receptor signaling pathway
    100428682 (PPP3R1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100428682 (PPP3R1)
   04921 Oxytocin signaling pathway
    100428682 (PPP3R1)
   04924 Renin secretion
    100428682 (PPP3R1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100428682 (PPP3R1)
   04720 Long-term potentiation
    100428682 (PPP3R1)
  09158 Development and regeneration
   04360 Axon guidance
    100428682 (PPP3R1)
   04380 Osteoclast differentiation
    100428682 (PPP3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100428682 (PPP3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100428682 (PPP3R1)
   05014 Amyotrophic lateral sclerosis
    100428682 (PPP3R1)
   05020 Prion disease
    100428682 (PPP3R1)
   05022 Pathways of neurodegeneration - multiple diseases
    100428682 (PPP3R1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100428682 (PPP3R1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100428682 (PPP3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100428682 (PPP3R1)
   05170 Human immunodeficiency virus 1 infection
    100428682 (PPP3R1)
   05163 Human cytomegalovirus infection
    100428682 (PPP3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100428682 (PPP3R1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100428682 (PPP3R1)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Other DBs
NCBI-GeneID: 100428682
NCBI-ProteinID: XP_014968077
Ensembl: ENSMMUG00000046264
UniProt: H9EN69
LinkDB
Position
13
AA seq 170 aa
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

KEGG   Macaca mulatta (rhesus monkey): 574258
Entry
574258            CDS       T01028                                 

Gene name
PPP3R2
Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    574258 (PPP3R2)
   04310 Wnt signaling pathway
    574258 (PPP3R2)
   04370 VEGF signaling pathway
    574258 (PPP3R2)
   04020 Calcium signaling pathway
    574258 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    574258 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    574258 (PPP3R2)
   04218 Cellular senescence
    574258 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    574258 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    574258 (PPP3R2)
   04660 T cell receptor signaling pathway
    574258 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    574258 (PPP3R2)
   04659 Th17 cell differentiation
    574258 (PPP3R2)
   04662 B cell receptor signaling pathway
    574258 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    574258 (PPP3R2)
   04921 Oxytocin signaling pathway
    574258 (PPP3R2)
   04924 Renin secretion
    574258 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    574258 (PPP3R2)
   04720 Long-term potentiation
    574258 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    574258 (PPP3R2)
   04380 Osteoclast differentiation
    574258 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    574258 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    574258 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    574258 (PPP3R2)
   05020 Prion disease
    574258 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    574258 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    574258 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    574258 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    574258 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    574258 (PPP3R2)
   05163 Human cytomegalovirus infection
    574258 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    574258 (PPP3R2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     574258 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 574258
NCBI-ProteinID: NP_001182349
LinkDB
Position
15
AA seq 173 aa
MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTNGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccaacggcgatggagaagtggacttcaaggaattcatcctg
gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc
cttatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

KEGG   Macaca mulatta (rhesus monkey): 706955
Entry
706955            CDS       T01028                                 

Gene name
PPP3CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit beta isoform isoform X7
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04728  Dopaminergic synapse
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    706955 (PPP3CB)
   04310 Wnt signaling pathway
    706955 (PPP3CB)
   04370 VEGF signaling pathway
    706955 (PPP3CB)
   04020 Calcium signaling pathway
    706955 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    706955 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    706955 (PPP3CB)
   04218 Cellular senescence
    706955 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    706955 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    706955 (PPP3CB)
   04660 T cell receptor signaling pathway
    706955 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    706955 (PPP3CB)
   04659 Th17 cell differentiation
    706955 (PPP3CB)
   04662 B cell receptor signaling pathway
    706955 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    706955 (PPP3CB)
   04921 Oxytocin signaling pathway
    706955 (PPP3CB)
   04924 Renin secretion
    706955 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    706955 (PPP3CB)
   04728 Dopaminergic synapse
    706955 (PPP3CB)
   04720 Long-term potentiation
    706955 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    706955 (PPP3CB)
   04380 Osteoclast differentiation
    706955 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    706955 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    706955 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    706955 (PPP3CB)
   05020 Prion disease
    706955 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    706955 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    706955 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    706955 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    706955 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    706955 (PPP3CB)
   05163 Human cytomegalovirus infection
    706955 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    706955 (PPP3CB)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     706955 (PPP3CB)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     706955 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 706955
NCBI-ProteinID: XP_015002800
UniProt: F6SFC6
LinkDB
Position
9
AA seq 514 aa
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPTTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAIRGFSPPHRICSFEEAKGLDRINE
RMPPRKDAVQQDGFNSLNTAHATDNHGTGNHTAQ
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggctgcaccgcccccgcccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccccccaacacatcgcttgacatct
gaagaagtatttgatctggatgggatacccagggttgatgttctgaagaatcacttggta
aaagaaggtcgagtagatgaagaaattgcgcttagaattatcaacgaaggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaatcacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggcgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggttctgaagattctatacccaaccacattatttcttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaagtattcg
gaaagagtctatgaagcttgtatggaagcttttgatagtttgcctcttgccgcactttta
aaccaacagtttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgtta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttgcccaattttatggatgtcttcaca
tggtctttaccgtttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccagtttgatggttcagctgcagcc
cggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttctct
gttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacagggatg
ttgcctagtggagtgttagctggaggacggcagaccctgcaaagtgcaatacgaggattc
tctccaccacatagaatctgcagttttgaagaggcaaagggtttggataggatcaatgag
agaatgccacctcggaaagatgctgtacagcaagatggtttcaattctctgaacaccgca
catgccactgacaaccacgggacgggcaaccatactgcccagtga

KEGG   Macaca mulatta (rhesus monkey): 708233
Entry
708233            CDS       T01028                                 

Gene name
PPP3CC
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform isoform X2
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04728  Dopaminergic synapse
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    708233 (PPP3CC)
   04310 Wnt signaling pathway
    708233 (PPP3CC)
   04370 VEGF signaling pathway
    708233 (PPP3CC)
   04020 Calcium signaling pathway
    708233 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    708233 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    708233 (PPP3CC)
   04218 Cellular senescence
    708233 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    708233 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    708233 (PPP3CC)
   04660 T cell receptor signaling pathway
    708233 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    708233 (PPP3CC)
   04659 Th17 cell differentiation
    708233 (PPP3CC)
   04662 B cell receptor signaling pathway
    708233 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    708233 (PPP3CC)
   04921 Oxytocin signaling pathway
    708233 (PPP3CC)
   04924 Renin secretion
    708233 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    708233 (PPP3CC)
   04728 Dopaminergic synapse
    708233 (PPP3CC)
   04720 Long-term potentiation
    708233 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    708233 (PPP3CC)
   04380 Osteoclast differentiation
    708233 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    708233 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    708233 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    708233 (PPP3CC)
   05020 Prion disease
    708233 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    708233 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    708233 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    708233 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    708233 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    708233 (PPP3CC)
   05163 Human cytomegalovirus infection
    708233 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    708233 (PPP3CC)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     708233 (PPP3CC)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     708233 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 708233
NCBI-ProteinID: XP_001103623
Ensembl: ENSMMUG00000014442
UniProt: F7BBG8
LinkDB
Position
8
AA seq 511 aa
MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRSKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSMHADGPVKSVASAHSHAAHRSDQGKKAQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgggaggcgcttccacctctccaccaccgaccgcgtcatcaaagctgtccccttt
cctccaacccaacggcttactttcaaggaagtatttgagaatgggaaacctaaagttgat
gttttaaaaaaccatttggtaaaagaaggacgactggaagaggaagtagccttaaagata
atcaatgatggggctgccatcctgaggcaagagaagactatgatagaagtagatgctcca
atcacagtgtgtggtgatattcatggacaattctttgacctaatgaaattatttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttatggagtttaaagattaatcatcccaaaacattg
ttcctgcttcggggaaatcatgaatgcaggcatcttacagactatttcaccttcaaacag
gaatgtcgaatcaaatattcggaacaggtgtatgatgcctgtatggagacatttgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaattacttctttagatgacattaggaaattagacaggtttacagaacctcccgccttt
ggacctgtgtgtgacctgctttggtctgatccctcagaggattatggcaatgagaagacc
ttggagcactatacccacaacactgtccgagggtgctcttatttctacagttaccctgca
gtttgtgaatttttgcagaacaataatttattatcaattatcagagcccatgaagcccaa
gatgctgggtatcgaatgtacaggaagagccaagcaacaggctttccatcacttattaca
attttctctgcccccaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaatatcaggcagtttaattgttctccacacccctactggcttcca
aactttatggatgttttcacatggtctttgccttttgttggggaaaaagtcacagagatg
ctggtaaatgtgctcaacatatgctctgatgacgaactgatttctgatgatgaagcggaa
ggaagcactacagttcgtaaggagatcatcaggagtaagatcagagccattgggaagatg
gcacgggtcttttcaattcttcggcaagaaagtgagagtgtgctgactctcaagggcctg
actcccacaggcacgctccctctgggtgtcctctcaggaggcaagcagactatcgagacg
gccacagtagaagcggtagaggcccgggaagccatcagagggttctcgcttcagcacaag
atccggagttttgaagaagcacgaggtctggaccgaattaatgaacgaatgccaccccga
aaagacagcatgcacgcggatgggccagtgaaatctgtagcctcagcacactcacacgcg
gcgcacaggagcgaccaagggaagaaagcccagtaa

KEGG   Macaca mulatta (rhesus monkey): 709773
Entry
709773            CDS       T01028                                 

Gene name
PPP3CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04020  Calcium signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04114  Oocyte meiosis
mcc04218  Cellular senescence
mcc04310  Wnt signaling pathway
mcc04360  Axon guidance
mcc04370  VEGF signaling pathway
mcc04380  Osteoclast differentiation
mcc04625  C-type lectin receptor signaling pathway
mcc04650  Natural killer cell mediated cytotoxicity
mcc04658  Th1 and Th2 cell differentiation
mcc04659  Th17 cell differentiation
mcc04660  T cell receptor signaling pathway
mcc04662  B cell receptor signaling pathway
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04728  Dopaminergic synapse
mcc04921  Oxytocin signaling pathway
mcc04922  Glucagon signaling pathway
mcc04924  Renin secretion
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05031  Amphetamine addiction
mcc05152  Tuberculosis
mcc05163  Human cytomegalovirus infection
mcc05166  Human T-cell leukemia virus 1 infection
mcc05167  Kaposi sarcoma-associated herpesvirus infection
mcc05170  Human immunodeficiency virus 1 infection
mcc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    709773 (PPP3CA)
   04310 Wnt signaling pathway
    709773 (PPP3CA)
   04370 VEGF signaling pathway
    709773 (PPP3CA)
   04020 Calcium signaling pathway
    709773 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    709773 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    709773 (PPP3CA)
   04218 Cellular senescence
    709773 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    709773 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    709773 (PPP3CA)
   04660 T cell receptor signaling pathway
    709773 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    709773 (PPP3CA)
   04659 Th17 cell differentiation
    709773 (PPP3CA)
   04662 B cell receptor signaling pathway
    709773 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    709773 (PPP3CA)
   04921 Oxytocin signaling pathway
    709773 (PPP3CA)
   04924 Renin secretion
    709773 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    709773 (PPP3CA)
   04728 Dopaminergic synapse
    709773 (PPP3CA)
   04720 Long-term potentiation
    709773 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    709773 (PPP3CA)
   04380 Osteoclast differentiation
    709773 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    709773 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    709773 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    709773 (PPP3CA)
   05020 Prion disease
    709773 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    709773 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    709773 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    709773 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    709773 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    709773 (PPP3CA)
   05163 Human cytomegalovirus infection
    709773 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    709773 (PPP3CA)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     709773 (PPP3CA)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     709773 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 709773
NCBI-ProteinID: NP_001248492
Ensembl: ENSMMUG00000004599
UniProt: H9EP04
LinkDB
Position
5
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALTSETNGTDSNGSNSSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcctaaggcaattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gttccatttcctccaagtcaccggcttacagcaaaagaagtgtttgataatgatggaaaa
cctcgtgtggatatcttaaaggcacatcttatgaaggagggaagactggaagagagtgtt
gcattgagaataataacagagggtgcatcaattcttcgacaggaaaaaaacttgctggat
attgatgcgccagtcacagtttgtggggacattcatggacaattctttgacttgatgaag
ctctttgaagtcgggggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgcgtatatgacgcctgtatggat
gcctttgactgccttcccttggctgccctgatgaaccaacagttcctgtgtgtacatggt
ggcttgtctccagagattaacaccttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcatatggacctatgtgtgatatcctgtggtcagaccccctggaagattttgga
aatgagaagactcaggaacatttcactcacaacacagtcagggggtgttcgtacttctac
agttacccggctgtatgtgaattcttacagcacaataacttgttatctatacttcgagcc
catgaagcccaagatgcagggtaccgcatgtacaggaaaagccaaacaacagggttccct
tctctaattacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttctcctcatcca
tactggcttccaaatttcatggatgtttttacttggtccctgccttttgttggggaaaaa
gtgactgagatgctggtaaatgtcctcaacatctgctctgatgatgaactagggtcagaa
gaagatggatttgatggtgcaacagctgcagcccggaaggaggtgataaggaacaagatc
cgagcaataggcaaaatggccagagtgttctcagtgctcagagaagagagtgagagtgtg
ctgacgctgaaaggcttgaccccgactggcatgctccccagcggagtactttctggaggg
aagcaaaccctacaaagcgctatcaaaggattttcaccacaacataagatcactagcttc
gaggaagccaagggcttagaccgaattaatgagaggatgccgcctcgcagagatgccatg
ccctctgacgccaaccttaactccatcaacaaggctctcacctcagagactaacggcacg
gacagcaatggcagtaatagcagcaatattcagtga

DBGET integrated database retrieval system