KEGG   Macaca mulatta (rhesus monkey): 100429106
Entry
100429106         CDS       T01028                                 

Gene name
GNA12
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-12 isoform X1
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04010  MAPK signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04730  Long-term depression
mcc04810  Regulation of actin cytoskeleton
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100429106 (GNA12)
   04072 Phospholipase D signaling pathway
    100429106 (GNA12)
   04071 Sphingolipid signaling pathway
    100429106 (GNA12)
   04022 cGMP-PKG signaling pathway
    100429106 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100429106 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100429106 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100429106 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    100429106 (GNA12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100429106 (GNA12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100429106 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    100429106 (GNA12)
   04031 GTP-binding proteins [BR:mcc04031]
    100429106 (GNA12)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100429106 (GNA12)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    100429106 (GNA12)
SSDB
Motif
Pfam: G-alpha Arf GTP_EFTU FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100429106
NCBI-ProteinID: XP_014988686
Ensembl: ENSMMUG00000006460
LinkDB
Position
3
AA seq 381 aa
MSGVVRTLSRCLLPAEAGGARERRAGGGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcggcggcgcgcgtgacgcggagcgcgaggcccggaggcgcagc
cgcgacatcgacgcactgctggcgcgcgagcggcgcgcggtccggcgcctggtgaagatc
ctgctgctgggcgcgggcgagagcggcaagtccacgttccttaagcagatgcgcatcatc
cacggccgcgagtttgaccagaaggcgctgctggagttccgcgacaccatcttcgacaac
atcctcaagggctcaagggttcttgttgatgcacgagataagcttggcattccctggcag
tattctgaaaatgagaagcatgggatgttcctgatggccttcgagaacaaggcggggctg
cctgtggagcccgccaccttccaactgtacgtcccggccctgagcgcactctggagggat
tctggcatcagggaggctttcagccggaggagcgagtttcagctgggggaatcagtgaag
tacttcctggacaacttggaccggatcggccagctgaattactttcctagtaagcaggac
atcctgctggcgaggaaggccaccaagggaattgtggagcatgacttcgttattaagaag
atcccatttaagatggtggatgtgggcggccagcggtcccagcgccagaagtggttccag
tgcttcgacgggatcacgtccatcctgttcatggtctcctccagcgagtacgaccaggtc
ctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatctttgagaccatc
gtcaacaacaagctcttcttcaacgtctccatcattctcttcctcaacaagatggacctc
ctggtggagaaggtgaagaccgtgagcatcaagaagcacttcccggacttcaggggtgac
ccgcacaggctagaggacgtccagcgctacctggtccagtgcttcgacaggaagagacgg
aaccgcagcaagccgctgttccaccacttcaccaccgccatcgacaccgagaacgtccgc
ttcgtgttccatgctgtgaaagacaccatcctgcaggagaacctgaaggacatcatgctg
cagtga

KEGG   Macaca mulatta (rhesus monkey): 718144
Entry
718144            CDS       T01028                                 

Gene name
GNA13
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-13 isoform X1
  KO
K04639  guanine nucleotide-binding protein subunit alpha-13
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04022  cGMP-PKG signaling pathway
mcc04071  Sphingolipid signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04611  Platelet activation
mcc04730  Long-term depression
mcc04810  Regulation of actin cytoskeleton
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc05163  Human cytomegalovirus infection
mcc05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    718144 (GNA13)
   04072 Phospholipase D signaling pathway
    718144 (GNA13)
   04071 Sphingolipid signaling pathway
    718144 (GNA13)
   04022 cGMP-PKG signaling pathway
    718144 (GNA13)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    718144 (GNA13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    718144 (GNA13)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    718144 (GNA13)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    718144 (GNA13)
  09156 Nervous system
   04730 Long-term depression
    718144 (GNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    718144 (GNA13)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    718144 (GNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mcc04147]
    718144 (GNA13)
   04031 GTP-binding proteins [BR:mcc04031]
    718144 (GNA13)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   718144 (GNA13)
  Exosomal proteins of colorectal cancer cells
   718144 (GNA13)
GTP-binding proteins [BR:mcc04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    718144 (GNA13)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 718144
NCBI-ProteinID: XP_014975612
Ensembl: ENSMMUG00000016371
UniProt: H9EP41
LinkDB
Position
16
AA seq 377 aa
MADFLPSRSVLSVCFPGCLLTSGEAEQQRKSKEIDKCLSREKTYVKRLVKILLLGAGESG
KSTFLKQMRIIHGQDFDQRAREEFRPTIYSNVIKGMRVLVDAREKLHIPWGDNSNQQHGD
KMMSFDTRAPMAAQGMVETRVFLQYLPAIRALWADSGIQNAYDRRREFQLGESVKYFLDN
LDKLGEPDYIPSQQDILLARRPTKGIHEYDFEIKNVPFKMVDVGGQRSERKRWFECFDSV
TSILFLVSSSEFDQVLMEDRLTNRLTESLNIFETIVNNRVFSNVSIILFLNKTDLLEEKV
QIVSIKDYFLEFEGDPHCLRDVQKFLVECFRNKRRDQQQKPLYHHFTTAINTENIRLVFR
DVKDTILHDNLKQLMLQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggacttcctgccgtcgcggtccgtgctgtccgtgtgcttccccggctgcttgctg
acgagcggcgaggccgagcagcaacgcaagtccaaggagatcgacaaatgcctgtctcgg
gaaaagacttacgtgaagcggctggtgaagatcctgctgctgggcgcaggcgagagcggc
aagtccaccttcctgaagcagatgcggatcatccacgggcaggatttcgaccagcgcgcg
cgcgaggagttccgccccaccatctacagcaacgtgatcaaaggtatgagggtgctggtt
gatgctcgagagaagcttcatattccctggggagataattcaaaccaacaacatggagat
aagatgatgtcgtttgatacccgggcccccatggcagcccaaggaatggtggaaacaagg
gttttcttacaatatcttcctgctataagagcattatgggcagacagcggcatacagaat
gcctatgaccggcgtcgagaatttcagctgggtgaatctgtaaaatatttcctggataac
ttggataaacttggagaaccagattatattccatcacaacaagatattctgcttgccaga
agacccaccaaaggcattcatgaatatgactttgaaattaaaaatgttcctttcaaaatg
gttgatgtaggtggtcagagatcagaaaggaaacgttggtttgagtgtttcgacagtgtc
acatcaatacttttccttgtttcctcaagtgaatttgaccaggtgcttatggaagatcga
ctgaccaatcgccttacagagtctctgaacatttttgaaacaatcgtcaataaccgggtt
ttcagcaatgtctccataattctgttcttaaacaagacagacttgcttgaggagaaggtg
caaattgtgagcatcaaagactatttcctagaatttgaaggggatccccactgcttaaga
gacgtccaaaaattcctggtggaatgtttccggaacaaacgccgggaccagcagcagaag
cccttataccaccacttcaccactgctatcaatacggagaacatccgccttgttttccgt
gatgtgaaggatactattctgcatgacaacctcaagcagcttatgctacagtga

DBGET integrated database retrieval system