KEGG   Macaca mulatta (rhesus monkey): 100429880
Entry
100429880         CDS       T01028                                 

Gene name
GRIN2A
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2A isoform X1
  KO
K05209  glutamate receptor ionotropic, NMDA 2A
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04728  Dopaminergic synapse
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05033  Nicotine addiction
mcc05034  Alcoholism
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100429880 (GRIN2A)
   04015 Rap1 signaling pathway
    100429880 (GRIN2A)
   04020 Calcium signaling pathway
    100429880 (GRIN2A)
   04024 cAMP signaling pathway
    100429880 (GRIN2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100429880 (GRIN2A)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100429880 (GRIN2A)
   04728 Dopaminergic synapse
    100429880 (GRIN2A)
   04720 Long-term potentiation
    100429880 (GRIN2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100429880 (GRIN2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100429880 (GRIN2A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100429880 (GRIN2A)
   05014 Amyotrophic lateral sclerosis
    100429880 (GRIN2A)
   05017 Spinocerebellar ataxia
    100429880 (GRIN2A)
   05020 Prion disease
    100429880 (GRIN2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100429880 (GRIN2A)
  09165 Substance dependence
   05030 Cocaine addiction
    100429880 (GRIN2A)
   05031 Amphetamine addiction
    100429880 (GRIN2A)
   05033 Nicotine addiction
    100429880 (GRIN2A)
   05034 Alcoholism
    100429880 (GRIN2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    100429880 (GRIN2A)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   100429880 (GRIN2A)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 100429880
NCBI-ProteinID: XP_028696778
Ensembl: ENSMMUG00000010142
LinkDB
Position
20
AA seq 1464 aa
MGRVGYWTLLVLPALLVWRGPAPSAAAEKGSPALNIAVMLGHSHDMTERELRTLWGPEQA
AGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
RDFISFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYTLEARVRDGIGILT
TAASSMLEKFSYIPEAKASCYGQMERPEIPMHTLHPFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGNMMYSDNRSFQGKESIFGDNM
NELQTFVANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKVNSRPRQLWKKSMDS
IRQDSLSQNPVSQRDEGTAENRTHSLKSPRYLPEEMAHSDVSETSNRATCHREPDNSKNH
KTKDNFKRSVASKYPKDCSEVERTYLKTKSSSPRDKIYTIDGEKEPGFHLDPPQFVENVT
LPENVDFPDPYQDHSENFRKGDSTLPMNRKPLHNEEGLPDTEQYKLYSKHFTLKDKGSPH
SETSERYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREQVYQQDWAQNNALQLQKNKLRISRQHSYDNIVDKPRELDLSRPSRSISLKDRERLL
EGNFYGSLFSVPSSKLSGNKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIG
RCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHNDVYISEHVMPYAANKNNMYS
TPRVLNSCSNRRVYKKMPSMESDV
NT seq 4395 nt   +upstreamnt  +downstreamnt
atgggcagagtgggctattggaccctgctggtgctgccggcccttctggtctggcgcggt
ccggcgccgagcgcggcggcggagaagggttcccccgcgctgaatattgcggtgatgctg
ggtcacagccacgacatgacagagcgcgaacttcgaaccctgtggggccccgagcaggcg
gcggggctgcccctggacgtgaacgtggtagctctgctgatgaaccgcaccgaccccaag
agcctcatcacgcacgtgtgcgacctcatgtccggggcacgcatccacggcctcgtgttt
ggggacgacacggaccaggaggccgtggcccagatgctggattttatctcctcccagacc
ttcatccccatcttgggcattcacgggggcgcatctatgatcatggctgacaaggatccg
acgtctaccttcttccagtttggagcatccatccagcagcaagccacggtcatgctgaag
atcatgcaggattatgactggcatgtcttctccctggtgaccaccatcttccctggctac
agggacttcatcagcttcgtcaagaccacggtggacaacagctttgtgggctgggacatg
cagaatgtgatcacactggacacttcctttgaggatgcaaagacacaagtccagttgaag
aagatccactcttctgtcatcttgctctactgttccaaagacgaggctgtcctcattctg
agtgaggcgcgttcccttggcctcaccgggtatgatttcttctggattgtccctagcttg
gtctctgggaacacggagctcatccccaaagagtttccatcgggactcatttccgtctcc
tacgatgactgggactacaccctggaggcgagagtgagggacggcattggcatcctaacc
actgctgcatcttctatgctggagaagttctcctacatccctgaggccaaggccagctgc
tacgggcagatggagaggccagagatcccaatgcacaccttgcacccatttatggtcaat
gttacatgggatggcaaagacttatccttcactgaggaaggctaccaggtgcatcccagg
ctggtggtgattgtgctgaacaaagaccgggaatgggaaaaggtgggcaagtgggagaac
cagacgctgagcctgaggcacgccgtgtggcccaggtacaagtccttctccgactgtgag
ccggatgacaaccatctcagcatcgtcaccctggaggaggccccgttcgtcattgtggaa
gatatagaccccctgaccgagacgtgtgtgaggaacactgtgccgtgtcggaagttcgtc
aaaatcaacaattcaaccaatgaggggatgaatgtgaagaaatgctgcaaggggttctgc
attgatattctgaagaagctttccagaactgtgaagtttacttacgacctctacctggtg
accaatgggaagcacggcaagaaagttaacaatgtgtggaatggaatgatcggtgaagtg
gtctatcaacgggcagtcatggcggttggttctctcaccatcaatgaggaacgttctgaa
gtggtggacttctctgtgccctttgtggaaacgggaatcagtgtcatggtttcaagaagt
aatggcaccgtctcaccttctgcttttctagaaccattcagcgcctctgtctgggtgatg
atgtttgtgatgctgctcattgtttctgccatagctgtttttgtctttgaatacttcagc
cctgttggatacaacagaaacttagccaaagggaaagcaccccatgggccttcttttaca
attggaaaagctatatggcttctttggggcctggtgttcaataactccgtgcctgtgcag
aatcctaaagggaccaccagcaagatcatggtatccgtatgggccttctttgctgttata
ttcctggccagctacacagccaatctggctgctttcatgatccaggaggaatttgtggac
caagtgactggcctcagtgacaaaaagtttcagagacctcatgactattccccacctttt
cgatttgggacagtgcctaatggaagcacggagagaaacattcggaataactatccctac
atgcatcagtacatgaccaaatttaatcagaagggagtagaggatgccttggtcagcctg
aaaacggggaagctggatgctttcatctatgatgccgcggtcttgaattacaaggccggg
agggatgaaggctgcaagctggtgaccatcgggagtgggtacatctttgccaccaccggt
tatggaattgcccttcagaaaggctctccttggaagaggcagatcgacctggctttgctt
cagtttgtgggtgatggtgagatggaggagctggagaccctgtggctcacggggatctgc
cacaacgagaagaacgaggtgatgagcagccagctggacattgacaacatggcgggcgtg
ttctacatgctggccgcggccatggcccttagcctcatcaccttcatctgggagcacctc
ttctactggaagctgcgcttctgtttcacgggcgtgtgctccgaccggcctgggttgctc
ttctccatcagcaggggcatctacagctgcattcatggagtgcacattgaagaaaagaag
aagtctccagacttcaatctgacaggatcccagagcaacatgttaaaactcctccggtca
gccaaaaacatttccaacatgtccaacatgaactcctcaagaatggactcacccaaaaga
gctgctgacttcatccaaagaggttcccttatcatggacatggtttcagataaggggaat
atgatgtactcggacaacaggtcctttcaggggaaagagagcatttttggagacaacatg
aacgaactccagacatttgtggccaaccggcacaaggataacctcaataactacgtattc
cagggacaacatcctctcactctcaatgagtccaaccctaacacggtggaggtggctgtg
agcacagaatccaaagtgaactctagaccccggcaactttggaagaaatccatggattcc
atacgccaggattcactatcccagaatccagtctcccagagggatgagggaacagcagag
aataggacccactccctaaagagccctaggtatcttccagaagagatggcccattctgac
gtttcagaaacgtcaaatcgggccacgtgccacagggaacctgacaacagtaagaaccac
aaaaccaaggacaactttaaaaggtcagtggcctccaaataccccaaggactgtagcgag
gtcgagcgcacctacctgaaaaccaaatcaagctccccgagagacaagatctacactatt
gatggtgagaaggagcctggttttcacttagatccaccccagtttgttgaaaatgtgacc
ctgcccgagaacgtggacttcccagacccctaccaggatcacagtgaaaacttccgcaag
ggcgactccacactgccaatgaaccggaagcccttgcataatgaagaggggcttcccgac
accgagcagtataaactctactccaagcacttcaccttgaaagacaagggttccccacac
agcgagaccagcgagcgataccggcagaactccacgcactgcagaagctgcctttccaac
ctgcccacctattcaggccacttcaccatgaggtcccccttcaagtgcgatgcctgcctg
cggatggggaacctctatgacatcgacgaagaccagatgcttcaggagacaggtaaccca
gccacccgggagcaggtctaccagcaggactgggcacagaacaatgcccttcaattacaa
aagaacaagctaaggattagccgtcagcattcctacgataacattgtcgacaaacctagg
gagctagaccttagcaggccctcccggagcataagcctcaaggacagggaacggcttctg
gagggaaatttttacggcagcctgtttagtgtcccctcaagcaaactctcggggaacaaa
agctcccttttcccccaaggtctggaggacagcaagaggagcaagtctctcttgccagac
cacacctccgataaccctttcctccactcccacagggatgaccaacgcttggttattggg
agatgcccctcggacccttacaaacactcgttgccatcccaggcggtgaatgacagctat
cttcggtcgtccttgaggtcaacggcatcgtactgttccagggacagtcggggccacaat
gatgtgtatatttcggagcatgttatgccttatgctgcaaataagaataatatgtactct
acccccagggttttaaattcctgcagcaatagacgtgtgtacaagaaaatgcctagtatg
gaatctgatgtttaa

KEGG   Macaca mulatta (rhesus monkey): 574380
Entry
574380            CDS       T01028                                 

Gene name
GRIN1
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 1 isoform X1
  KO
K05208  glutamate receptor ionotropic, NMDA 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05033  Nicotine addiction
mcc05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    574380 (GRIN1)
   04015 Rap1 signaling pathway
    574380 (GRIN1)
   04020 Calcium signaling pathway
    574380 (GRIN1)
   04024 cAMP signaling pathway
    574380 (GRIN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    574380 (GRIN1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    574380 (GRIN1)
   04720 Long-term potentiation
    574380 (GRIN1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    574380 (GRIN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    574380 (GRIN1)
   05014 Amyotrophic lateral sclerosis
    574380 (GRIN1)
   05016 Huntington disease
    574380 (GRIN1)
   05017 Spinocerebellar ataxia
    574380 (GRIN1)
   05020 Prion disease
    574380 (GRIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    574380 (GRIN1)
  09165 Substance dependence
   05030 Cocaine addiction
    574380 (GRIN1)
   05031 Amphetamine addiction
    574380 (GRIN1)
   05033 Nicotine addiction
    574380 (GRIN1)
   05034 Alcoholism
    574380 (GRIN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    574380 (GRIN1)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   574380 (GRIN1)
SSDB
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 CaM_bdg_C0 Ion_trans_2
Other DBs
NCBI-GeneID: 574380
NCBI-ProteinID: XP_014971750
Ensembl: ENSMMUG00000001661
UniProt: A0A5K1UHG2
LinkDB
Position
15
AA seq 959 aa
MSTMRLLTLALLFSCSVARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYSWNHIILLVSDDHEGRAAQKRL
ETLLEERESKSKKRNYENLDQLSYDNKRGPKAEKVLQFDPGTKNVTALLMEAKELEARVI
ILSASEDDAATVYRAAAMLNMTGSGYVWLVGEREISGNALRYAPDGILGLQLINGKNESA
HISDAVGVVAQAVHELLEKENITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVE
FNEDGDRKFANYSIMNLQNRKLVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLK
IVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFC
IDLLIKLARTMNFTYEVHLVADGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTI
NNERAQYIEFSKPFKYQGLTILVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYL
LDRFSPFGRFKVNSEEEEEDALTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGF
AMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVEL
STMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFG
IGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFML
VAGGIVAGIFLIFIEIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKAT
FRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
NT seq 2880 nt   +upstreamnt  +downstreamnt
atgagcaccatgcgcctgctgacgctcgccctgctgttctcctgctccgtcgcccgtgcc
gcgtgcgaccccaagatcgtcaacattggcgcggtgctgagcacgcggaagcacgagcag
atgttccgcgaggccgtgaaccaggccaacaagcggcatggttcctggaagatccagctg
aacgccacctccgtcacgcacaagcccaacgccatccagatggctctgtcagtgtgcgag
gacctcatctccagccaggtctacgccatcctagttagccatccgcctacccccaacgac
cacttcactcccacccctgtctcctacacagccggcttctaccgtatccccgtgctgggg
ctgaccacccgcatgtccatctactccgacaagagcatccacctgagcttcctgcgcacc
gtgccgccctactcccaccagtcgagcgtgtggttcgagatgatgcgtgtctacagctgg
aaccacatcatcctgctggtcagcgacgaccacgagggccgggcggctcagaagcgcctg
gagacgctgctggaggagcgtgagtccaagagtaaaaaaaggaactatgaaaacctcgac
caactgtcctatgacaacaagcgcggacccaaggcagagaaggtgctgcagtttgaccca
gggaccaagaacgtgacagccctgctgatggaggcaaaagagctggaggcccgggtcatc
atcctttctgccagcgaggacgatgctgccactgtgtaccgtgcagctgcgatgctgaac
atgacgggctccgggtacgtgtggctggtcggggagcgcgagatctcggggaacgccctg
cgctacgccccggacggcatcctcgggctgcagctcatcaacggcaagaacgagtcagcc
cacatcagcgacgccgtgggcgtggtggcccaggccgtgcacgagctcctcgagaaggag
aacatcaccgacccgccgcggggctgcgtgggcaacaccaacatctggaagaccgggccg
ctcttcaagagagtgttgatgtcctccaagtatgcggacggggtgactggtcgtgtggag
ttcaatgaggatggggaccggaagttcgccaactacagcatcatgaacctgcagaaccgc
aagctggtgcaagtgggcatctacaacggcacccatgtcatccctaatgacaggaagatc
atctggccaggcggagagacagagaagcctcgagggtaccagatgtccaccagactgaag
attgtgacgatccaccaggagcctttcgtgtacgtcaagcccacgctgagtgatgggaca
tgcaaggaggagttcacagtcaatggcgacccagtcaagaaggtgatctgcaccgggccc
aatgacacgtctccgggcagcccccgccacacggtgcctcagtgttgctacggcttttgc
atcgacctgctcatcaagctggcacggaccatgaacttcacctacgaggtgcacctggtg
gcagatggcaagttcggcacacaggagcgggtgaacaacagcaacaagaaggagtggaat
gggatgatgggcgagctgctcagcgggcaggcagacatgatcgtggcgccgctaaccatc
aacaacgagcgcgcgcagtacatcgagttttccaagcccttcaagtaccagggcctgact
attctggtcaagaaggaaatcccccggagcacgctagactcgttcatgcagccgttccag
agcacactgtggctgctggtggggctgtcggtgcacgtggtggccgtgatgctgtacctg
ctggaccgcttcagccccttcggccggttcaaggtgaacagcgaggaggaggaggaggac
gcactgaccctgtcctcggccatgtggttctcctggggcgtcctgctcaactccggcatc
ggggaaggcgcccccagaagcttctcggcgcgtatcctgggcatggtgtgggccggcttt
gccatgattatcgtggcctcctacaccgccaacctggcggccttcctggtgctggaccgg
ccggaggagcgcatcaccggcatcaacgaccctcggctgaggaacccctcggacaagttt
atctacgccacggtgaagcagagctccgtggacatctacttccggcgccaggtggagctg
agcaccatgtaccggcacatggagaagcacaactacgagagcgcagcggaggccatccag
gccgtgagagacaacaagctgcatgccttcatctgggactcggctgtgctggagttcgag
gcctcgcagaagtgcgacctggtgacgactggagagctgttcttccgctcgggcttcggc
ataggcatgcgcaaagacagcccctggaagcagaacgtctccctatccatcctcaagtcc
catgagaatggcttcatggaagacctggacaagacgtgggttcggtatcaggagtgtgac
tcgcgcagcaacgcccctgcgacccttacttttgagaacatggcaggggtcttcatgctg
gtagcggggggcatcgttgccgggatcttcctgattttcattgagattgcctacaagcgg
cacaaggacgctcgcaggaagcagatgcagctggcctttgcagcggtgaacgtgtggagg
aagaacctgcaggatagaaagagtggtagagcagagcctgaccctaaaaagaaagccaca
tttagggctatcacctccaccctggcttccagcttcaagaggcgtaggtcctccaaagac
acgagcaccgggggtggacgcggcgctttgcaaaaccaaaaagacacagtgctgccgcga
cgcgctattgagagggaggagggccagctgcagctgtgttcccgtcatagggagagctga

KEGG   Macaca mulatta (rhesus monkey): 698571
Entry
698571            CDS       T01028                                 

Gene name
GRIN2B
Definition
(RefSeq) glutamate receptor ionotropic, NMDA 2B isoform X1
  KO
K05210  glutamate receptor ionotropic, NMDA 2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04014  Ras signaling pathway
mcc04015  Rap1 signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04713  Circadian entrainment
mcc04720  Long-term potentiation
mcc04724  Glutamatergic synapse
mcc04728  Dopaminergic synapse
mcc05010  Alzheimer disease
mcc05014  Amyotrophic lateral sclerosis
mcc05016  Huntington disease
mcc05017  Spinocerebellar ataxia
mcc05020  Prion disease
mcc05022  Pathways of neurodegeneration - multiple diseases
mcc05030  Cocaine addiction
mcc05031  Amphetamine addiction
mcc05033  Nicotine addiction
mcc05034  Alcoholism
mcc05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    698571 (GRIN2B)
   04015 Rap1 signaling pathway
    698571 (GRIN2B)
   04024 cAMP signaling pathway
    698571 (GRIN2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    698571 (GRIN2B)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    698571 (GRIN2B)
   04728 Dopaminergic synapse
    698571 (GRIN2B)
   04720 Long-term potentiation
    698571 (GRIN2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    698571 (GRIN2B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    698571 (GRIN2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    698571 (GRIN2B)
   05014 Amyotrophic lateral sclerosis
    698571 (GRIN2B)
   05016 Huntington disease
    698571 (GRIN2B)
   05017 Spinocerebellar ataxia
    698571 (GRIN2B)
   05020 Prion disease
    698571 (GRIN2B)
   05022 Pathways of neurodegeneration - multiple diseases
    698571 (GRIN2B)
  09165 Substance dependence
   05030 Cocaine addiction
    698571 (GRIN2B)
   05031 Amphetamine addiction
    698571 (GRIN2B)
   05033 Nicotine addiction
    698571 (GRIN2B)
   05034 Alcoholism
    698571 (GRIN2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mcc04040]
    698571 (GRIN2B)
Ion channels [BR:mcc04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   698571 (GRIN2B)
SSDB
Motif
Pfam: NMDAR2_C Lig_chan Lig_chan-Glu_bd SBP_bac_3 ANF_receptor
Other DBs
NCBI-GeneID: 698571
NCBI-ProteinID: XP_015006663
Ensembl: ENSMMUG00000019112
UniProt: G7N6E0 F6T8S6
LinkDB
Position
11
AA seq 1484 aa
MKPRAECCSPKFWLVLAVLAVSGSRARSQKSPPSIGIAVILVGTSDEVAIKDAHEKDDFH
HLSVVPRVELVAMNETDPKSIITRICDLMSDRKIQGVVFADDTDQEAIAQILDFISAQTL
TPILGIHGGSSMIMADKDESSMFFQFGPSIEQQASVMLNIMEEYDWYIFSIVTTYFPGYQ
DFVNKIRSTIENSFVGWELEEVLLLDMSLDDGDSKIQNQLKKLQSPIILLYCTKEEATYI
FEVANSVGLTGYGYTWIVPSLVAGDTDTVPAEFPTGLISVSYDEWDYGLPARVRDGIAII
TTAASDMLSEHSFIPEPKSSCYNTHEKRIYQSNMLNRYLINVTFEGRNLSFSEDGYQMHP
KLVIILLNKERKWERVGKWKDKSLQMKYYVWPRMCPETEEQEDDHLSIVTLEEAPFVIVE
SVDPLSGTCMRNTVPCQKRIITENKTDEEPGYIKKCCKGFCIDILKKISKSVKFTYDLYL
VTNGKHGKKINGTWNGMIGEVVMKRAYMAVGSLTINEERSEVVDFSVPFIETGISVMVSR
SNGTVSPSAFLEPFSADVWVMMFVMLLIVSAVAVFVFEYFSPVGYNRCLADGREPGGPSF
TIGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEYV
DQVSGLSDKKFQRPNDFSPPFRFGTVPNGSTERNIRNNYAEMHAYMGKFNQRGVDDALLS
LKTGKLDAFIYDAAVLNYMAGRDEGCKLVTIGSGKVFASTGYGIAIQKDSGWKRQVDLAI
LQLFGDGEMEELEALWLTGICHNEKNEVMSSQLDIDNMAGVFYMLGAAMALSLITFICEH
LFYWQFRHCFMGVCSGKPGMVFSISRGIYSCIHGVAIEERQSVMNSPTATMNNTHSNILR
LLRTAKNMANLSGVNGSPQSALDFIRRESSVYDISEHRRSFTHSDCKSYNNPPCEENLFS
DYISEVERTFGNLQLKDSNVYQDHYHHHHRPHSIGSASSIDGLYDCDNPPFTTQSRSISK
KPLDIGLPSSKHSQLSDLYGKFSFKSDRYSGHDDLIRSDVSDISTHTVTYGNIEGNAAKR
RKQQYKDSLKKRPASAKSRREFDEIELAYRRRPPRSPDHKRYFRDKEGLRDFYLDQFRTK
ENSPHWEHVDLTDIYKERSDDFKRDSVSGGGPCTNRSHIKHGAGDKHGVVSGVPAPWEKN
LTNVEWEDRSGGNFCRSCPSKLHNYSTTVTGQNSGRQACIRCEACKKAGNLYDISEDNSL
QELDQPAAPVAVTSNASTTKYPQSPTNSKAQKKNRNKLRRQHSYDTFVDLQKEEAALAPR
SVSLKDKGRFMDGSPYAHMFEMSAGESTFANNKSSVPTAGHHHHNNPGGGYMLSKSLYPD
RVTQNPFIPTFGDDQCLLHGSKSYFFRQPTVAGASKARPDFRALVTNKPVVSALHGAVPA
RFQKDICIGNQSNPCVPNNKNPRAFNGSSNGHVYEKLSSIESDV
NT seq 4455 nt   +upstreamnt  +downstreamnt
atgaagcccagagcggagtgctgttctcccaagttctggttggtgttggctgtcctggcc
gtgtcaggcagcagagctcgttctcagaagagcccccccagcattggcattgctgtcatc
ctcgtgggcacttccgacgaggtggccatcaaggatgcccacgagaaagatgatttccac
catctctccgtggtgcctcgggtggaactggtagccatgaatgagaccgacccaaagagc
atcatcacccgcatctgtgatctcatgtctgaccggaagatccagggggtggtgtttgct
gatgacacagaccaggaagccatcgcccagatcctcgatttcatttctgcacagactctc
acccctatcctgggcatccacgggggctcctctatgataatggcagataaggatgaatcc
tccatgttcttccagtttggcccatcaattgaacagcaagcttccgtaatgctcaacatc
atggaagaatatgactggtacatcttttctatcgtcaccacctatttccctggctaccag
gactttgtaaacaagatccgcagcaccattgagaatagctttgtgggctgggagctagag
gaagtcctcctactggacatgtccctggacgatggagattctaagatccagaatcagctc
aagaaacttcaaagccccatcattcttctttactgtaccaaggaagaagccacctacatc
tttgaagtggccaactcagtagggctgactggctacggctacacgtggatcgtgcccagt
ctggtggcaggggatacagacacagtgcctgcggagttccccactgggctcatctctgta
tcatatgatgaatgggactacggcctccccgccagagtgagagatggaattgccataatc
accactgctgcttctgacatgctgtccgaacacagcttcatccctgagcccaaaagcagt
tgttacaatacccatgagaagagaatctaccagtccaatatgctaaataggtatctgatc
aacgtcacttttgaggggaggaatctgtccttcagtgaagatggttaccagatgcaccca
aagctggtgataattcttctgaacaaggagaggaagtgggaaagggtggggaagtggaaa
gacaagtccctgcagatgaagtactatgtgtggccccgaatgtgtccagagactgaagag
caggaagatgaccatctgagcattgtgaccctggaggaggcaccatttgtcattgtggaa
agtgtggaccctctgagtggaacctgcatgaggaacacagtcccctgccaaaaacgcata
atcactgagaataaaacagatgaggagccgggttacatcaaaaaatgctgcaaggggttc
tgtatcgacatccttaagaaaatttctaaatctgtgaagttcacctatgacctttacctg
gttaccaatggcaagcatgggaagaaaatcaatggaacctggaatggtatgattggagag
gtggtcatgaagagggcctacatggcggtgggctcactcaccatcaatgaggaacgatcg
gaggtggtcgacttctctgtgcccttcatagagacaggcatcagtgtcatggtgtcacgc
agcaatgggactgtctcaccttctgccttcttagagccattcagtgctgacgtatgggtg
atgatgtttgtgatgctgctcatcgtctcagctgtggctgtctttgtctttgagtacttc
agccctgtgggttataacaggtgcctcgctgatggcagagagcctggtggcccctctttc
accatcggcaaagctatttggttgctctggggtctggtgtttaacaactccgtacctgtg
cagaacccaaaggggaccacctccaagatcatggtgtcagtgtgggccttctttgctgtc
atcttcctggccagctacactgccaacttagctgccttcatgatccaagaggaatatgtg
gaccaggtttctggcttgagcgacaaaaagttccagagacctaatgacttctcaccccct
ttccgctttgggaccgtgcccaacggcagcacagagagaaatattcgcaataactatgca
gaaatgcatgcctacatgggaaagttcaaccagaggggtgtagatgatgcattgctctcc
ctgaaaacagggaaactggatgccttcatctatgatgcagcagtgctgaactatatggca
ggcagagatgaaggctgcaagctggtgaccattggcagtgggaaggtctttgcttccact
ggctatggcattgccatccaaaaagattctgggtggaagcgccaggtggaccttgctatc
ctgcagctctttggagatggggagatggaagaactggaagctctctggctcactggcatt
tgtcacaatgagaagaatgaggtcatgagcagccagctggacattgacaacatggcaggg
gtcttctacatgttgggggcggccatggctctcagcctcatcaccttcatctgcgaacac
cttttctattggcagttccgacattgctttatgggtgtctgttctggcaagcctggcatg
gtcttctccatcagcagaggcatctacagctgcatccatggggtggcgatcgaggagcgc
caatccgtaatgaactcccccaccgcaaccatgaacaacacacactccaacatcctgcgc
ctgctgcgcacagccaagaacatggctaacctgtctggtgtgaacggctccccgcagagc
gccctggacttcatccgacgggagtcatctgtctatgacatctcggagcatcgccgcagc
ttcacacattctgactgcaaatcctacaacaacccgccctgtgaggagaacctcttcagt
gactacatcagtgaggtggagagaacgttcgggaacctgcagctgaaggacagcaacgtg
taccaagatcactaccaccatcaccaccggccccatagcatcggcagtgccagctccatc
gatggcctctacgactgtgacaacccacccttcaccacccagtccaggtccatcagcaag
aagcccctggacatcggcctcccctcctccaagcacagccagctcagtgacctgtacggc
aaattctccttcaagagcgaccgctacagtggccacgatgacctgatccgctccgatgtc
tctgacatctcaacccacaccgtcacctacgggaacatcgagggcaatgccgccaagagg
cgtaagcagcaatataaggacagcctgaagaagcggcccgcctcggccaagtcccgcagg
gagtttgacgagatcgagctggcctaccgtcgccgaccgccccgctcccctgaccacaag
cgctacttcagggacaaggaagggctacgggacttctacctggaccagttccgaacaaag
gagaactcaccccactgggagcacgtggacctgaccgacatctacaaggagcggagtgac
gactttaagcgcgactcggtcagcggaggagggccctgtaccaacaggtcccacatcaag
cacggggcaggtgacaaacacggcgtggtcagtggggtacctgcaccgtgggagaagaac
ctgaccaacgtggagtgggaggaccggtccgggggcaacttctgccgcagctgtccctcc
aagctgcacaactactccacgacggtgacgggtcagaactcgggcaggcaggcgtgcatc
cggtgcgaggcttgcaagaaagcaggcaacctatatgacatcagcgaggacaactccctg
caggaactggaccagccggctgccccggtggcggtgacgtcaaacgcctccaccactaag
tatcctcagagcccgactaattccaaggcccagaagaagaaccggaacaaactgcgccgg
cagcactcctacgacaccttcgtggacctgcagaaggaagaagccgccctggccccgcgc
agcgtaagcctgaaagacaagggccgattcatggatgggagcccctacgcccacatgttt
gagatgtcagctggcgagagcacctttgccaacaacaagtcctcagtgcccactgccgga
catcaccaccacaacaaccccggcggcggctacatgctcagcaagtcgctctaccctgac
cgggtcacgcaaaaccctttcatccccacttttggggacgaccagtgcttgctccatggc
agcaaatcctacttcttcaggcagcccacggtggcgggggcgtcgaaagccaggccggac
ttccgggcccttgtcaccaacaagccggtggtctcggcccttcatggggccgtgccagcc
cgtttccagaaggacatctgtatagggaaccagtccaacccctgtgtgcctaacaacaaa
aaccccagggctttcaatggctccagcaatgggcatgtttatgagaaactttctagtatt
gagtctgatgtctga

DBGET integrated database retrieval system