KEGG   Macaca mulatta (rhesus monkey): 100430348Help
Entry
100430348         CDS       T01028                                 

Gene name
TGM6
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100430348 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100430348
NCBI-ProteinID: XP_015004892
LinkDB All DBs
Position
10
AA seq 706 aa AA seqDB search
MAGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRAPDCEETFIFMVET
GPRASEALHTKAVFQTSELELGEGWTAAKEAQMENTLTVSLASPPNAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPGHQNNPATDVSCRHDPIYVTRVISAMVNSNNDRGVVQGQWQG
KYDGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVKRLFSVKASGRRTWIRRAGGRC
LWHDDLLEPTTKPSITGKFKLLEPPMLGHDLRLALCLANLTSRVQQVRVNLSGATILYTR
KPVAEILHESHAVRLGRQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAMVGVAVTVEVTVVNPLLERVKDCALMVEGSGFLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIIHVATAK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcagagtcaccaaggtggactggcagcggtcgaggaatggcgctgcccac
cacacccaggagtacccctgccctgagctggtggttcgcaggggccagtcgttcagcctc
acgctggagctgagcagagccccggactgcgaggagaccttcatcttcatggtggagaca
ggaccccgggcttctgaggccctccacaccaaagctgtgttccagacatcggagctggag
ctgggtgagggctggacagcagcaaaggaggctcagatggagaacactctgaccgtcagt
ctcgccagccctcccaatgctgtcattggccgctacctgctgagcatcaggctttcctct
caccgcaaacacagcaaccggaggctgggcgagtttgttcttcttttcaacccatggtgt
gcagaggacgatgtgtttctggcctcagaggaggagagacaggagtacgtgctcaacgac
agcggcatcatcttccgaggcgtggagaagcacatacgagcccagggctggaactacggg
cagtttgaggaggacatcctgaacatctgcctctccatcctggatcgaagccccggtcac
caaaacaacccagccaccgacgtgtcctgccgccacgaccccatctacgtcaccagggtc
atcagcgccatggtgaacagcaacaatgaccgaggtgtggtgcaaggacagtggcagggc
aagtacgacggcggcaccagcccgctgcactggcgtggcagcgtggccattctgcagaag
tggctcaagggcaggtacaagccagtcaagtacggccagtgctgggtcttcgcgggagtc
atgtgcacagtcctcaggtgcttggggatagccacacgggtcgtgtccaacttcaactca
gcccacgacacagaccagaacctgagtgtggacaaatacgtggactccttcgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctaggcccctcttacaatggctggcaggttctggatgccaccccccag
gaggagagtgaaggtgtgttccggtgcggcccagcctcagtcactgccatccgcgagggt
gatgtgcacctggcccacgatggccccttcgtgtttgcggaggtcaacgctgactacatc
acctggctgtggcacgaggatgagagccgagagcgtgtatactcgaacacgaagaagatt
gggagatgcatcagcactaaggcggtaggcagcgactcccgtgtggacatcaccgacctc
tacaagtatccggaagggtcccggaaagagaggcaggtgtacagcaaggcggtgaagagg
ttgttcagcgtgaaagcctctggaaggagaacctggatccgcagggctggggggcgctgt
ctctggcatgatgacctcctagagcccaccaccaagcccagcatcactggcaagttcaag
ctgctagagcctcccatgctgggccacgacctgagactggccctgtgcttggccaacctc
acctcccgggtccagcaggtgagggtcaacctgagcggtgccaccatcctctacacccgc
aagccggtggcagagatcctgcatgaatcccacgccgtgaggctgggacgacaagaagag
aagagaatcccaattacaatatcttactctaagtataaagaagacctgacagaggacaag
aagatcctgttggctgccatgtgcctcgtcaccaaaggagagaagcttctggtggagaag
gacattactctagaggacttcatcaccatcaaggttctgggcccagccatggtgggagtg
gcagttacggtggaagtgacagtagtcaaccccctcttagaaagagtgaaggactgtgcg
ctgatggtggagggcagcggctttctccaggaacagctcagcatcgacgtgcccaccctg
gagcctcaggagagggcctcagtccagtttgacatcaccccctccaagagtggcccaagg
cagttgcaggtggaccttgtaagccctcactttccggacatcaagggttttgtgatcatc
catgtggccactgccaagtga

DBGET integrated database retrieval system